Align BadK (characterized)
to candidate CA265_RS20005 CA265_RS20005 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Pedo557:CA265_RS20005 Length = 259 Score = 145 bits (366), Expect = 8e-40 Identities = 95/261 (36%), Positives = 137/261 (52%), Gaps = 9/261 (3%) Query: 1 MSSNPILTETQGRVGIITLNRPDVLNALN-DALMDALGGALLAFDADDGIGAIVIAGNTR 59 M+ +++E + + +T+NR LNALN D L + A D+ G I+ + Sbjct: 1 MAYQNLISEIKENILYVTINREKALNALNKDTLAELADVIAFAGRTDEVRGVILTGAGEK 60 Query: 60 AFAAGADIASMAAWSYSDVYGSNFITRNWE----TIRQIRKPVLAAVAGLAYGGGCELAL 115 AF AGADI + YS G R E I KP +AA+ G A GGG ELA+ Sbjct: 61 AFVAGADIKEFS--DYSGKQGEELAKRGHELVFNAIENSSKPFIAAINGFALGGGLELAM 118 Query: 116 ACDIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYG 175 AC I IA +AK LPE+ LGL+PG GGTQRL + +GK KA++M +A + A +A++ G Sbjct: 119 ACHIRIASDNAKLGLPEVTLGLIPGYGGTQRLTQLVGKGKAIEMITTANMITATDAEKIG 178 Query: 176 LVSRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARF 235 LV+ VV L + + I + A+ A +S+ + +T G E E F Sbjct: 179 LVNVVVPQADLIGKAEEMLNVIKQRAPLAISAAIKSVIASINNT--NGYATEIEEFGKCF 236 Query: 236 ASADAREGIQAFLEKRAPCFS 256 +AD +EG+ AF+EKR F+ Sbjct: 237 ETADFKEGVTAFVEKRKAIFT 257 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory