Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate CA265_RS19580 CA265_RS19580 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__Pedo557:CA265_RS19580 Length = 331 Score = 117 bits (293), Expect = 4e-31 Identities = 85/321 (26%), Positives = 142/321 (44%), Gaps = 11/321 (3%) Query: 33 AAAGVPPDRQLLMYRAMVVGRAFNRQATAFSRQGRLAVYPSSR-GQEACQVGSALAVRPT 91 +A + D L + +M++ R F + Q ++ + GQEA G+ A++ Sbjct: 2 SAVEINKDTWLKWFESMLLMRKFEEKTGQLYGQQKIRGFCHLYIGQEAVVAGAISAMQKG 61 Query: 92 DWLFPTYRESVALLTRGIDPVQVLTLFRGDQH-CGYDP-------VTEHTAPQCTPLAT- 142 D + TYR+ L G+ ++ G C EH + Sbjct: 62 DSMITTYRDHAHALALGVSADSIMAEMYGKATGCSKGKGGSMHMFSKEHNFYGGHAIVGG 121 Query: 143 QCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYAI 202 Q AG+A A + G V + Y+GDGA +G +E N A + + PV+F+ +NN YA+ Sbjct: 122 QIPLGAGVAFAEKYKGTDNVNICYMGDGAVRQGALNETFNMAMLWKLPVIFVCENNGYAM 181 Query: 203 SVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAVTY 262 + + T + G+ MP +DG D + V+ A+ +A +RAR G GPT +E TY Sbjct: 182 GTSVQRTTNMTDIYKIGLGFDMPCAPVDGMDPVAVHNAMDEAIQRARKGEGPTFLEMRTY 241 Query: 263 RIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGVLDRAAADGIAAAADAFAGE 322 R H + D +YR E + + A+DPV+ +L D+A + + A A + Sbjct: 242 RYRGH-SMSDPAKYRTKEELEDYKAKDPVEHARETILKEKYADQAWIEEVEAKVKAIVDQ 300 Query: 323 LSARFSAPPTGDPMQMFRHVY 343 P D ++++ VY Sbjct: 301 AVKFAEESPWPDASELYKDVY 321 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 368 Length of database: 331 Length adjustment: 29 Effective length of query: 339 Effective length of database: 302 Effective search space: 102378 Effective search space used: 102378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory