Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate CA265_RS18405 CA265_RS18405 dehydrogenase
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__Pedo557:CA265_RS18405 Length = 658 Score = 201 bits (511), Expect = 4e-56 Identities = 124/305 (40%), Positives = 170/305 (55%), Gaps = 12/305 (3%) Query: 9 ALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAESAILGTAV 68 A+ L A++ P +L G+DI GG F+ITDG A++G R +TP+ ESAI+G + Sbjct: 346 AITDGLDLAMQKYPNLVLMGQDIADYGGAFKITDGFTAKYGRGRVRNTPICESAIVGAGL 405 Query: 69 GMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYGGGIGGVEH 128 G+++ GY+ VVEMQF F F Q+V+++AK R + +R+P G G G Sbjct: 406 GLSINGYKAVVEMQFADFVTVGFNQIVNNLAK--THYRWGEKADVVVRMPTGAGTGAGPF 463 Query: 129 HSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRKEALGLPVD 188 HS S+E ++ TPGL +V PA DA LL +I P+PV++ E K LY +L PV Sbjct: 464 HSQSNEAWFTKTPGLKIVYPAFPEDAKGLLLAAIEDPNPVLYFEHKYLY---RSLSAPVP 520 Query: 189 TG----PLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLMPLDDA 244 G +G AV G T+I YG V AL+ E E G L IDLRTL P D Sbjct: 521 DGYYTTEIGKAVRLAEGDKFTIITYGLGVHWALDYMEQYPESGATL--IDLRTLQPWDKE 578 Query: 245 TVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP-PPLL 303 TV A+V+ TGR +++HE G GAE++A I E CF +L+APV R D P +L Sbjct: 579 TVSAAVKATGRVLILHEDTLTNGFGAELSAWIGEHCFAYLDAPVMRCASLDTAIPMSKIL 638 Query: 304 ERHYL 308 E +L Sbjct: 639 EEDFL 643 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 658 Length adjustment: 33 Effective length of query: 295 Effective length of database: 625 Effective search space: 184375 Effective search space used: 184375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory