Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate CA265_RS09125 CA265_RS09125 methylglutaconyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >FitnessBrowser__Pedo557:CA265_RS09125 Length = 258 Score = 116 bits (291), Expect = 4e-31 Identities = 76/256 (29%), Positives = 132/256 (51%), Gaps = 14/256 (5%) Query: 6 ILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKAFAAGA 65 +L + R+ +T+NRP+ NALN L+ EL AA + DD + +++ + AF+AGA Sbjct: 5 VLYQVAERIATITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDAFSAGA 64 Query: 66 DIGMMSTYTYM----DVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDIIF 121 D+ + Y +V +++ + + T+ + K +IA V G A+ GGC LA +CDI+F Sbjct: 65 DLAYLQQLQYNTFEENVADSNHLKKLFTTIYYLPKVVIAQVEGHAIAGGCGLATICDIVF 124 Query: 122 AADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVI 181 A + FG E+K+G +P A + L VS++ A ++ LT + A EA + L++ V Sbjct: 125 ATPESNFGYTEVKIGFVP-AIVSCFLKEKVSESIAKEILLTGKIFSAEEALKYNLINFVT 183 Query: 182 PAASLVDEAIAAAATIAEFPSPAVMM-----VKESVNRAYETTLAEGVHFERRLFHSLFA 236 ++ + A ++ S +M + ++ N E L V R+ S Sbjct: 184 NSSDIHQIVREFALSLCSGSSGNSLMITKQLITQTTNPLLEKCLETAVQINARVRES--- 240 Query: 237 TEDQKEGMAAFVEKRK 252 ED K+G+++F+ K K Sbjct: 241 -EDFKKGISSFLNKEK 255 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory