Align Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (characterized)
to candidate CA265_RS17585 CA265_RS17585 acetyl-CoA acetyltransferase
Query= reanno::Marino:GFF2751 (415 letters) >FitnessBrowser__Pedo557:CA265_RS17585 Length = 391 Score = 289 bits (739), Expect = 1e-82 Identities = 181/412 (43%), Positives = 237/412 (57%), Gaps = 35/412 (8%) Query: 9 DAYIVDAIRTPIGRYG-GALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLYGCANQAG 67 +AYI+ RT +G+ G RADDL A I+AL P+LD +IDDV+ G A Sbjct: 2 EAYIIAGYRTAVGKAPRGVFRFTRADDLAAEVIRALVASVPNLDNEQIDDVIVGNATPEA 61 Query: 68 EDNRDVARMSLLLAGLPVD-VPGSTINRLCGSGMDAVGSAARAIRTGETQLMIAGGVESM 126 E ++ RM + L GL D VPG T+NR C SG+D + +A I+ G +IAGGVE M Sbjct: 62 EQGLNIGRM-ISLMGLDTDKVPGVTVNRYCASGLDTIATAVAKIKAGMADCIIAGGVEVM 120 Query: 127 SRAPFVMGKADSAFSRKAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADFGISRED 186 S PF K AE+ W + M TAE VA ++ +SRED Sbjct: 121 SGMPFGGWK----LVPNAEVAKNNPDWYW------------GMGLTAEAVAKEYNVSRED 164 Query: 187 QDAFALRSQQRTAAAQKEGRLAAEITPVTIP--------RRKQDPLVVDTDEHPR-ETSL 237 QDAF+L+S ++ A K G L I P+T+ ++K VVDTDE PR +T+L Sbjct: 165 QDAFSLKSHEKAIHAIKNGHLKDGILPITVNENYLDANLKKKTRSYVVDTDEGPRADTTL 224 Query: 238 EKLASLPTPFRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVEP 297 +KLA L F G+VTAGN+S +DGA +L+ +K+ N +P AR+V+ AGV P Sbjct: 225 DKLAKLKPVFDAVGSVTAGNSSQTSDGAAFVLVVSEKKMKELNAEPIARLVSYGIAGVPP 284 Query: 298 RIMGFGPAPATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGGA 357 RIMG GP A K L AGL+ D+D+IELNEAFA+Q+LAV R L L D +N NGGA Sbjct: 285 RIMGIGPIEAIPKALKQAGLKKEDIDLIELNEAFASQSLAVIRTLDLNPDV--INVNGGA 342 Query: 358 IALGHPLGMSGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIE 409 IALGHPLG +GA+L +NEL+R Q +Y + TMC+G GQG A I E Sbjct: 343 IALGHPLGCTGAKLTVQIMNELKR-----QNKKYGMVTMCVGTGQGAAGIFE 389 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 415 Length of database: 391 Length adjustment: 31 Effective length of query: 384 Effective length of database: 360 Effective search space: 138240 Effective search space used: 138240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory