GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Pedobacter sp. GW460-11-11-14-LB5

Align long-chain-aldehyde dehydrogenase (EC 1.2.1.48) (characterized)
to candidate CA265_RS21385 CA265_RS21385 aldehyde dehydrogenase family protein

Query= BRENDA::P51648
         (485 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS21385 CA265_RS21385 aldehyde
           dehydrogenase family protein
          Length = 465

 Score =  360 bits (925), Expect = e-104
 Identities = 187/433 (43%), Positives = 268/433 (61%), Gaps = 8/433 (1%)

Query: 16  RSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENL 75
           R    + R+ +L+ L++ +++ E++I  A+ ADL K+ F     E+     EID  ++ L
Sbjct: 20  RKTDAKTRIGKLKLLKQALEKAEEEIYAALEADLRKNRFETAVTELFFTYAEIDHAIKKL 79

Query: 76  PEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIK 135
             W+  K V + +  +     I  +P GV LII  WNYP  L + PL+ AIAAGN VI+K
Sbjct: 80  QGWMKPKSVARTMSNLFASNKIYYEPKGVCLIIAPWNYPLQLIMSPLVSAIAAGNCVILK 139

Query: 136 PSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVME 195
           PSELS  TA +++KL+    + +      G  E +T LLK  FDHIF+TG+TA+GK+VME
Sbjct: 140 PSELSAATADVISKLISNTFEAEEIACFEGDAEVSTALLKLPFDHIFFTGSTAIGKVVME 199

Query: 196 AAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQN 255
           AAAK+LT VTLELGGKSP  +D+ CDL     +I WGK +N GQTCIAPDY+L + ++  
Sbjct: 200 AAAKNLTSVTLELGGKSPAIVDETCDLKKAAEKIAWGKLVNAGQTCIAPDYVLIKENISA 259

Query: 256 QIVWKIKETV-KEFYGENIKESPDYERIINLRHFKRILSLLE-----GQKIAFGGETDEA 309
                 +  V K F+ E      DY +IIN++ F+R+  L+E     G  +AFGG++DE 
Sbjct: 260 DFEMYYQAAVQKMFFNEAAINKNDYAKIINIKQFQRLNKLIEEAIRDGAVLAFGGKSDEQ 319

Query: 310 TRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHK 369
              I PT+LT V   + +MQEEIFGP+LP++  +N+ EAI+ +N + KPLALY+FS +  
Sbjct: 320 NLTITPTLLTSVAESSAIMQEEIFGPVLPVITYQNLQEAIDVVNRKAKPLALYIFSDSTT 379

Query: 370 LIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKS 429
              ++I ETS+GG   NDV++H      PFGGV +SG+G+ HG   F TFSH+R  + +S
Sbjct: 380 NQNKIISETSAGGTCVNDVLVHIGNPDLPFGGVNNSGIGSCHGIFGFKTFSHERAVVFQS 439

Query: 430 LKREGANKLRYPP 442
             +    K+ YPP
Sbjct: 440 --KLDLTKMIYPP 450


Lambda     K      H
   0.321    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 537
Number of extensions: 16
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 485
Length of database: 465
Length adjustment: 33
Effective length of query: 452
Effective length of database: 432
Effective search space:   195264
Effective search space used:   195264
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory