Align long-chain-aldehyde dehydrogenase (EC 1.2.1.48) (characterized)
to candidate CA265_RS21385 CA265_RS21385 aldehyde dehydrogenase family protein
Query= BRENDA::P51648 (485 letters) >FitnessBrowser__Pedo557:CA265_RS21385 Length = 465 Score = 360 bits (925), Expect = e-104 Identities = 187/433 (43%), Positives = 268/433 (61%), Gaps = 8/433 (1%) Query: 16 RSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENL 75 R + R+ +L+ L++ +++ E++I A+ ADL K+ F E+ EID ++ L Sbjct: 20 RKTDAKTRIGKLKLLKQALEKAEEEIYAALEADLRKNRFETAVTELFFTYAEIDHAIKKL 79 Query: 76 PEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIK 135 W+ K V + + + I +P GV LII WNYP L + PL+ AIAAGN VI+K Sbjct: 80 QGWMKPKSVARTMSNLFASNKIYYEPKGVCLIIAPWNYPLQLIMSPLVSAIAAGNCVILK 139 Query: 136 PSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVME 195 PSELS TA +++KL+ + + G E +T LLK FDHIF+TG+TA+GK+VME Sbjct: 140 PSELSAATADVISKLISNTFEAEEIACFEGDAEVSTALLKLPFDHIFFTGSTAIGKVVME 199 Query: 196 AAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQN 255 AAAK+LT VTLELGGKSP +D+ CDL +I WGK +N GQTCIAPDY+L + ++ Sbjct: 200 AAAKNLTSVTLELGGKSPAIVDETCDLKKAAEKIAWGKLVNAGQTCIAPDYVLIKENISA 259 Query: 256 QIVWKIKETV-KEFYGENIKESPDYERIINLRHFKRILSLLE-----GQKIAFGGETDEA 309 + V K F+ E DY +IIN++ F+R+ L+E G +AFGG++DE Sbjct: 260 DFEMYYQAAVQKMFFNEAAINKNDYAKIINIKQFQRLNKLIEEAIRDGAVLAFGGKSDEQ 319 Query: 310 TRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHK 369 I PT+LT V + +MQEEIFGP+LP++ +N+ EAI+ +N + KPLALY+FS + Sbjct: 320 NLTITPTLLTSVAESSAIMQEEIFGPVLPVITYQNLQEAIDVVNRKAKPLALYIFSDSTT 379 Query: 370 LIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKS 429 ++I ETS+GG NDV++H PFGGV +SG+G+ HG F TFSH+R + +S Sbjct: 380 NQNKIISETSAGGTCVNDVLVHIGNPDLPFGGVNNSGIGSCHGIFGFKTFSHERAVVFQS 439 Query: 430 LKREGANKLRYPP 442 + K+ YPP Sbjct: 440 --KLDLTKMIYPP 450 Lambda K H 0.321 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 465 Length adjustment: 33 Effective length of query: 452 Effective length of database: 432 Effective search space: 195264 Effective search space used: 195264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory