GapMind for catabolism of small carbon sources

 

Aligments for a candidate for CCNA_00435 in Pedobacter sp. GW460-11-11-14-LB5

Align Amino acid transporter (characterized, see rationale)
to candidate CA265_RS15000 CA265_RS15000 amino acid permease

Query= uniprot:A0A0H3C3Q5
         (483 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS15000 CA265_RS15000 amino acid
           permease
          Length = 491

 Score =  304 bits (779), Expect = 4e-87
 Identities = 183/467 (39%), Positives = 270/467 (57%), Gaps = 21/467 (4%)

Query: 30  LKKTLSWPHLVALGVGAIVGTGIYTLTGVGAGL-AGPGVILSFLIAGAVCACAALCYAEL 88
           LK+TLS   LVALGVGAI+G G++  T   A   AGP V + F+IA   CA A LCYAEL
Sbjct: 23  LKRTLSAGALVALGVGAIIGAGLFVRTAAAAAQNAGPSVTIGFIIAAIGCALAGLCYAEL 82

Query: 89  STMIPASGSAYTYSYAAMGEPVAWFVGWSLILEYTLVCAAVAVGWSAHAHGLFKMI---- 144
           S+ IP SGSAYTY+YA MGE +AW +GW L+LEY +  A V + WS + + L   +    
Sbjct: 83  SSSIPISGSAYTYTYATMGELMAWVIGWDLVLEYAVGAATVGIAWSEYLNKLLVEVLHTS 142

Query: 145 GFPDALLAGPHQ-------GGLINMPAVFISMAVAGLLALGTRESATVNMVLVFVKIIAL 197
             P      P Q        G++N+PA+FI   ++ LL  GT ESA VN ++V  K+  +
Sbjct: 143 PIPYEWCHSPFQSHPDGTVNGIMNLPALFIVGLLSLLLIKGTSESAFVNGLIVITKVGIV 202

Query: 198 IVFVVLCLPAFNLAHFTPFMPNGFQAHVPEGAAADA--AKVGVMAAASLIFFAFYGFDAV 255
           I+ +VL     N ++  P++P     +V     + +     GV+ AA  +FFAF GFDAV
Sbjct: 203 ILIIVLGWGFINESNHHPYIP-AATTYVDHAGISHSFGGFWGVIGAAGTVFFAFIGFDAV 261

Query: 256 STAAEETKNPKRDLTIGIVGSMAVCTAIYMIVAAVSIGASRTEVF--SKSEAPLVFILES 313
           STAA+ETKNPK  + IGI+GS+AVCT +Y++ A V  G +  E F     EA +V  +  
Sbjct: 262 STAAQETKNPKTAMPIGILGSLAVCTVLYILFAHVLTGIAPVEFFRTKGGEASVVAAISE 321

Query: 314 LNHGK--IAQLVALAAVIALPTVILAFMYGQSRIFFVMARDGLLPRALSKVNAKTGTPVM 371
              G   +++LV +A +    +VIL  + GQSR+F+ M++DGLLP+  S ++ K  TP  
Sbjct: 322 YMTGYSWLSKLVTVAILAGFSSVILVMLLGQSRVFYSMSKDGLLPKMFSDLHPKFKTPYK 381

Query: 372 MTLLTGVLAAVISGLLSLKDIAELANAGTLWAFIAVGASVILLRLREPNRPRVFSTPLWP 431
             L+  ++  + +  +    + ++ + GTL+AF+ V  +VI+LR  +P+ PR F TP  P
Sbjct: 382 ANLVILIIVGLFAAFIPGDVVGDMTSIGTLFAFMLVCVAVIILRKTDPDLPRQFKTPWVP 441

Query: 432 IVAPAGILGCLYLFLSLPGKTQLYFLYAHL-IGAVVYLAYGMRKSVL 477
           ++   G++ C  + L L G T    L+  L +G ++Y  Y  + S L
Sbjct: 442 LIPILGVVACGLMILGL-GWTNWLRLFGWLALGFIIYFGYSKKNSHL 487


Lambda     K      H
   0.326    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 673
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 491
Length adjustment: 34
Effective length of query: 449
Effective length of database: 457
Effective search space:   205193
Effective search space used:   205193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory