Align NAD-dependent succinate semialdehyde dehydrogenase (EC 1.2.1.24) (characterized)
to candidate CA265_RS01080 CA265_RS01080 6-phosphogluconate dehydrogenase
Query= metacyc::MONOMER-15565 (287 letters) >FitnessBrowser__Pedo557:CA265_RS01080 Length = 285 Score = 172 bits (437), Expect = 6e-48 Identities = 102/284 (35%), Positives = 160/284 (56%), Gaps = 5/284 (1%) Query: 3 EIGFLGIGIMGKAMAVNLLRHGFKVTVWNRTLSRCDELVQHGASVGETPAEVIKKCKYTI 62 +IG++G+G MG MA L+ G+ V V+NR+ + L + GAS+ +TP ++I I Sbjct: 5 KIGWIGLGNMGIPMAEQLINAGYAVMVYNRSKDKEASLKEMGASIAQTPQDLITTTDVVI 64 Query: 63 AMLSDPAAALSVVFDKHGALEHICAGKGYIDMSTVDADTSSQISQAITSKGGSFLEAPVS 122 M+SD AA + + G L +GK I+MSTV S +++ + G +L+APVS Sbjct: 65 VMVSDDAAIAQIFNGEGGLLRVETSGKIIINMSTVSPSISKEMAALCKANGNFYLDAPVS 124 Query: 123 GSKKPAEDGQLVILAAGDKDLYDQVVPAFDVLGKKSFFLGKIGNGAKMKLVVNMIMGSMM 182 GS K AE GQLVI+ G++D+++QV P + +GK + +G+ G G KL +N ++ Sbjct: 125 GSVKQAETGQLVIMVGGEEDVFNQVKPILEKMGKLAKLVGENGAGNSAKLAINSLLALYA 184 Query: 183 NAFSEGIVLADKSGLDPHTLLDVLDLGAIANPMFKMKGPAMIKNSYPPAFPLKHQQKDMR 242 +E ++ A+K G+ LL++++ AI N K+KG A+I + Y AF LKH KD+ Sbjct: 185 QGLAETVLFANKQGIKTSDLLELINNAAIGNIFTKIKGDAIIADHYKAAFALKHIVKDLN 244 Query: 243 LALALGDENAVPMPVAAAANEAFKKARSLGLGDLDFSAVFETLS 286 LA A G + P+A A F A + G+ D A+ + LS Sbjct: 245 LAKAEG----ISSPLAKTALNTFGDA-AAKYGEEDIIAIIKQLS 283 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 285 Length adjustment: 26 Effective length of query: 261 Effective length of database: 259 Effective search space: 67599 Effective search space used: 67599 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory