Align 4-aminobutyrate transaminase subunit (EC 2.6.1.19) (characterized)
to candidate CA265_RS18530 CA265_RS18530 aspartate aminotransferase family protein
Query= metacyc::MONOMER-11537 (425 letters) >FitnessBrowser__Pedo557:CA265_RS18530 Length = 382 Score = 199 bits (506), Expect = 1e-55 Identities = 128/340 (37%), Positives = 197/340 (57%), Gaps = 26/340 (7%) Query: 23 IHPIFADSAKNATVTDVEGREFIDFAGGIAVLNTGHVHPKIIAAVTEQLNKLTHTCFQVL 82 ++ I A + V D ++++D GG AV++ GH +P + +T+QLNK+ V Sbjct: 9 LNDIEITKAAGSNVWDANDQQYLDLYGGHAVISIGHTNPHYVNRLTDQLNKVGFYSNSV- 67 Query: 83 AYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGAYHGR 142 V+L EK+ +V G + L +G+EA ENA+K+A GR VIAFTGA+HGR Sbjct: 68 KIPLQVQLAEKLG-EVSGKKDFQLFLCNSGAEANENALKLASFYNGRKKVIAFTGAFHGR 126 Query: 143 TMMTLGLTG--KVVPYSAGMGLMPGGIFRALYPNELHGVSIDDSIASIERIFKNDAEPRD 200 T + + +T K+V A + IF + NE+ ++E FK A+ + Sbjct: 127 TSLAVAVTDNPKIV---APVNQTENVIFLP-FNNEI----------ALEETFK--AQGNE 170 Query: 201 IAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGV 260 I+A+IIE +QG GG A K F++++R+LCD++ + IAD VQ G GRTG+F++ + GV Sbjct: 171 ISAVIIEGIQGVGGIKEASKSFLQKIRSLCDEYNAVYIADSVQCGYGRTGSFYSHDYSGV 230 Query: 261 TADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVMEVFEEEH 320 AD+ T AK + GFP+AG+ +++ G LG T+ G+ +ACAAALAV+EV E+++ Sbjct: 231 EADVYTMAKGMGNGFPVAGISIASKFKP--WHGELGTTFGGNHLACAAALAVLEVMEKDN 288 Query: 321 LLDRCKAVGERLVTGLKAIQAKYPVIGEVRALGAMIAVEL 360 L+ + VG L+ LK K+ + EVR G MI +EL Sbjct: 289 LIKNAEEVGNYLIAELK----KFEQVVEVRGRGLMIGIEL 324 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 382 Length adjustment: 31 Effective length of query: 394 Effective length of database: 351 Effective search space: 138294 Effective search space used: 138294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory