Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate CA265_RS10520 CA265_RS10520 ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__Pedo557:CA265_RS10520 Length = 568 Score = 144 bits (363), Expect = 6e-39 Identities = 89/237 (37%), Positives = 139/237 (58%), Gaps = 10/237 (4%) Query: 25 KCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHV 84 K D + + QL+ + GE L L+G SGCGKTT+ R I L SG I+ + E+ITH+ Sbjct: 328 KTTDYVKAVDQLNFEVFPGETLGLVGESGCGKTTLGRTILRLIQPTSGEIIFNGENITHI 387 Query: 85 PAE-----NRYVNTVFQS-YA-LFPHMTVFENVAFGLRMQKTPA--AEITPRVMEALRMV 135 + + +FQ YA L P +++ +++ L++ K +E +V+E L V Sbjct: 388 GKTALRKLRKDIQIIFQDPYASLNPKLSIGQSILEPLQVHKLYRNDSERKQKVLELLDKV 447 Query: 136 QL-ETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQ 194 L E R PH+ SGGQ+QRV IARA+ +P+ ++ DES+SALD ++ Q+ N +K LQ Sbjct: 448 GLKEEHFNRYPHEFSGGQRQRVVIARALALQPKFIICDESVSALDVSVQAQVLNLIKDLQ 507 Query: 195 RKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEI 251 + G+T++F++HD +SDRI+VM G+IE++G P +I+ PK + I I Sbjct: 508 SEFGLTYIFISHDLAVVKHISDRILVMNKGKIEEEGFPEQIFYAPKAAYTQKLIEAI 564 Score = 93.2 bits (230), Expect = 2e-23 Identities = 66/234 (28%), Positives = 114/234 (48%), Gaps = 16/234 (6%) Query: 31 EVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIM--LDNEDITHVPAEN 88 + + Q+ + G L ++G SG GK+ I L + +I +D EDI+ + + Sbjct: 21 KAVKQISFKVKKGTVLGIVGESGSGKSVTSFSIMRLHDERAAKITGEIDFEDISLLNLSS 80 Query: 89 R--------YVNTVFQS--YALFPHMTVFENVAFGLRM-QKTPAAEITPRVMEALRMVQL 137 ++ +FQ +L P T VA + + +K AE + VQL Sbjct: 81 NEIRQIRGNQISMIFQEPMTSLNPVFTCGYQVAEAIMLHRKVDQAEAKKHTIALFNEVQL 140 Query: 138 ---ETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQ 194 E + PHQ+SGGQ+QRV IA A+ P+LL+ DE +ALD ++K + L L+ Sbjct: 141 PRPEKIFESYPHQISGGQKQRVMIAMALSCDPKLLIADEPTTALDVTVQKTILQLLLKLK 200 Query: 195 RKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFI 248 ++ + +F++HD ++D + VM G I + G + I+E P++ + G + Sbjct: 201 QERNMAMIFISHDLGVVNEIADEVAVMYKGEIVEQGPAKSIFENPQHPYTKGLL 254 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 378 Length of database: 568 Length adjustment: 33 Effective length of query: 345 Effective length of database: 535 Effective search space: 184575 Effective search space used: 184575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory