Align Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= TCDB::Q97Q42 (385 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 151 bits (381), Expect = 3e-41 Identities = 77/249 (30%), Positives = 150/249 (60%), Gaps = 8/249 (3%) Query: 1 MKKPIIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDAT 60 M II KN++K ++ +K+++FE+++G ++G SGSGKST+L I GLL Sbjct: 1 MSNTIISVKNLTKQYQAEQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTD 60 Query: 61 TGDIMLDGVRIND-----IPTNKRDVHTVFQSYALFPHMNVFENVAFPLRLRKIDKKEIE 115 G+I + R+ IP +K+ + V Q ++L + V++N+A +L D K Sbjct: 61 EGEIFFEDKRVKGPDEQLIPGHKQ-MKMVTQDFSLNIYAKVYDNIAS--QLSNTDLKTKA 117 Query: 116 QRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEPLSALDLKLRTD 175 ++ ++++ +++ + + I +LSGG++QRVAIA+A++ +V+LLDEP S +D L+ Sbjct: 118 EKTLQIMEHLRILPLQNKKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQ 177 Query: 176 MQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVDIYDEPINHFVA 235 ++ +++ + G+T + V+HD + L ++D + ++ +GE++Q+G P +IY P + + A Sbjct: 178 LRADIKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTA 237 Query: 236 TFIGESNIL 244 +G + +L Sbjct: 238 QILGNAVVL 246 Lambda K H 0.318 0.138 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 330 Length adjustment: 29 Effective length of query: 356 Effective length of database: 301 Effective search space: 107156 Effective search space used: 107156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory