Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate CA265_RS08650 CA265_RS08650 short-chain dehydrogenase
Query= metacyc::MONOMER-16231 (254 letters) >FitnessBrowser__Pedo557:CA265_RS08650 Length = 248 Score = 127 bits (320), Expect = 2e-34 Identities = 89/256 (34%), Positives = 134/256 (52%), Gaps = 19/256 (7%) Query: 1 MKLLEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIA 60 M L GK LVTG ++GIG A A GA+V I D AE+ +G Sbjct: 1 MSNLTGKKALVTGGNSGIGYATAKELKAQGAEVIITGRRKDA-VDKAAAELGVIGL---- 55 Query: 61 VKGDVADPQ--TAQDFVAKAVET-FGKVDVMVSNAGICPFHAFLDMPVDVVERTFKVNLH 117 VAD TA + +A VE+ F K+D++ NAG+ + + + F +N Sbjct: 56 ----VADQSQITAIEGLASDVESIFNKIDILFINAGVVEQSSIAEATEKSFDTIFGINFK 111 Query: 118 GAYFMVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGK 177 GAYF + M G S+V +SS +A + G + YT +K+ ++S+M+ A+ L Sbjct: 112 GAYFTLSKFIPLM---NDGSSVVFLSSNTAHMDGAKSSIYTSSKSALNSVMRIAAVELAP 168 Query: 178 HGIRCNSVLPGTILTEI-NKDDLADQEKR---EYMEARTPLGRLGAPEDLAGPIVFLASD 233 IR NSV PG I TEI NK L +++ +++ +R+PLG++G ED+A + F D Sbjct: 169 RQIRVNSVSPGPIATEIMNKMGLNEEQLNGINQWLISRSPLGKIGKSEDVAKMVAFFCGD 228 Query: 234 MAAYVTGAALLVDGGM 249 A Y+TGA +++DGGM Sbjct: 229 AATYITGAEIVMDGGM 244 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory