Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate CA265_RS03145 CA265_RS03145 fumarylacetoacetate hydrolase
Query= reanno::Smeli:SM_b21112 (281 letters) >FitnessBrowser__Pedo557:CA265_RS03145 Length = 331 Score = 96.7 bits (239), Expect = 6e-25 Identities = 70/207 (33%), Positives = 101/207 (48%), Gaps = 34/207 (16%) Query: 95 PIIFMKATSAIVGPNDDLVLPRGSEKTDWEVELGIVIGKTAKYVSEAEALDYVAGYCTVH 154 PI + +AI G + +P +K D+E+E+ IVIGK + + AEA +Y+AGY ++ Sbjct: 111 PIFYFTNHNAIQGTGEIECMPDHFDKLDFELEIAIVIGKKGRNIKAAEADEYIAGYMVMN 170 Query: 155 DVSERAFQTER---HGQWTKGKSCDTFGPTGPWLVTKDE------------VADPQDLAM 199 D+S R Q E + KGK T GPWLVT DE V DL M Sbjct: 171 DMSARTLQMEEMLLNLGPAKGKDFSTV--IGPWLVTPDELLQYKVAPKAGHVGHAYDLKM 228 Query: 200 WLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIISTGTPPGVGMG--------- 250 +VNG + G+ M + A ++ + + + PGD+I +GT VG G Sbjct: 229 TCRVNGIEVSKGNAADMDWTFAEIIERCAYGVDILPGDVIGSGT---VGTGCFLELNGTG 285 Query: 251 -MKPPRY----LKAGDVVELGIEGLGS 272 + P Y L+ GDVVE+ I GLG+ Sbjct: 286 LLNDPNYKVQWLQPGDVVEMEITGLGA 312 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 331 Length adjustment: 27 Effective length of query: 254 Effective length of database: 304 Effective search space: 77216 Effective search space used: 77216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory