Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate CA265_RS21785 CA265_RS21785 L-serine ammonia-lyase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5557 (458 letters) >FitnessBrowser__Pedo557:CA265_RS21785 Length = 475 Score = 438 bits (1126), Expect = e-127 Identities = 238/467 (50%), Positives = 314/467 (67%), Gaps = 18/467 (3%) Query: 3 LSVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDDLLNCTTSVKVELYGSLGATGKGHG 62 +SVFD+FKIGIGPSSSHT+GP RAA +F L ++ L++ +K+ LYGSL TGKGHG Sbjct: 6 ISVFDIFKIGIGPSSSHTLGPWRAAQQFTASLAQNHLIDEIEGIKILLYGSLAKTGKGHG 65 Query: 63 SDKAVLLGLEGEHPDTVDTETVDARLQAIRSSGRLNLLGEHSIEFN-EKLHLAMIRKPLA 121 +D A+LLGL G P T D + V ++I+ +LNL G I+F+ + L + + L Sbjct: 66 TDVAILLGLTGADPVTFDVDAVTPTFESIQRDQKLNLAGHLIIDFDYDNDLLFLFAESLP 125 Query: 122 FHPNGMIFRAFDAAGLQVRSREYYSVGGGFVVDEGAAGADRIVEDATPLTFPFKSAKDLL 181 FHPN + F+AF G + S YYS+GGGFVV EG D + L FP + AKDLL Sbjct: 126 FHPNAVTFQAFLKGG-KAFSETYYSIGGGFVVKEGE---DNSKKPQVDLPFPVEKAKDLL 181 Query: 182 GHCSTYGLSISQVMLTNESAWRPEAETRAGLLKIWQVMQDCVAAGCRNEGILPGGLKVKR 241 C + GL +S++++ NE AWR EAET+ G+L+ + VM DC+ GC G LPGGL V R Sbjct: 182 HWCLSTGLKVSEIVMENELAWRTEAETKKGILQHFAVMSDCIYRGCHTTGFLPGGLNVAR 241 Query: 242 RAAALHRQLCKNPE--------AALRDPLS----VLDWVNLYALAVNEENAYGGRVVTAP 289 RA L+++L E A+R + LDWV+ +ALAVNEENA GRVVTAP Sbjct: 242 RAFPLNKRLIGKSEYSDYNSWVEAIRKGGNGFNYTLDWVSCFALAVNEENASFGRVVTAP 301 Query: 290 TNGAAGIIPAVLHYYMRFIPGASEDGVVRFLLTAAAIGILYKENASISGAEVGCQGEVGV 349 TNGAAG+IPAVL Y++ F G SE+ +++F+ A+ IG ++K+ A+IS A GCQ E+GV Sbjct: 302 TNGAAGVIPAVLQYFITFCDGYSEEKIMQFIACASEIGSIFKKGATISAAMGGCQAEIGV 361 Query: 350 ACSMAAGALCEVLGGSVQQVENAAEIGMEHNLGLTCDPIGGLVQVPCIERNAMGSVKAIN 409 + +MAA AL E LGGS +QV AAEI MEH+LGLTCDPIGGLVQ+PCIERN MG++KAI Sbjct: 362 SSAMAAAALTECLGGSQRQVLMAAEIAMEHHLGLTCDPIGGLVQIPCIERNTMGAIKAIT 421 Query: 410 AVRMAMRGDGHHF-VSLDKVIRTMRQTGADMKSKYKETARGGLAVNI 455 A ++A++ + VSLD V+ TM +T DM +KYKET+ GGLA NI Sbjct: 422 ASQLALQSNPDKAKVSLDAVVNTMWETALDMNAKYKETSDGGLATNI 468 Lambda K H 0.320 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 475 Length adjustment: 33 Effective length of query: 425 Effective length of database: 442 Effective search space: 187850 Effective search space used: 187850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate CA265_RS21785 CA265_RS21785 (L-serine ammonia-lyase)
to HMM TIGR00720 (L-serine ammonia-lyase (EC 4.3.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00720.hmm # target sequence database: /tmp/gapView.27522.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00720 [M=450] Accession: TIGR00720 Description: sda_mono: L-serine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-180 585.1 0.0 7e-180 584.7 0.0 1.2 1 lcl|FitnessBrowser__Pedo557:CA265_RS21785 CA265_RS21785 L-serine ammonia-l Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS21785 CA265_RS21785 L-serine ammonia-lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 584.7 0.0 7e-180 7e-180 1 450 [] 6 468 .. 6 468 .. 0.95 Alignments for each domain: == domain 1 score: 584.7 bits; conditional E-value: 7e-180 TIGR00720 1 isvfdlfkiGiGPssshtvGPmkaakefveelkkkgkleqvkrvkvdlyGslaltGkGhktdkavllG 68 isvfd+fkiGiGPsssht+GP +aa++f ++l ++ +++++ +k+ lyGsla tGkGh+td a+llG lcl|FitnessBrowser__Pedo557:CA265_RS21785 6 ISVFDIFKIGIGPSSSHTLGPWRAAQQFTASLAQNHLIDEIEGIKILLYGSLAKTGKGHGTDVAILLG 73 79****************************************************************** PP TIGR00720 69 leGelpeevdiesieklleeveeekklklanqkeikfdlekdlafk.devlplhenglrlkaydeege 135 l+G +p + d++ ++ +e++++++kl+la++ i+fd+++dl f e+lp+h+n+++++a+ + g+ lcl|FitnessBrowser__Pedo557:CA265_RS21785 74 LTGADPVTFDVDAVTPTFESIQRDQKLNLAGHLIIDFDYDNDLLFLfAESLPFHPNAVTFQAFLKGGK 141 *********************************************99****************99965 PP TIGR00720 136 vlkektyysvGGGfivdeeelkkeeeeeeevpypfksaaellelCkeeglsisevvlenekalrseee 203 ++tyys+GGGf+v+e e +++++ ++++p+p + a++ll+ C ++gl++se+v+ene a+r+e+e lcl|FitnessBrowser__Pedo557:CA265_RS21785 142 -AFSETYYSIGGGFVVKEGE-DNSKKPQVDLPFPVEKAKDLLHWCLSTGLKVSEIVMENELAWRTEAE 207 .5689***********9876.56678889*************************************** PP TIGR00720 204 vraklleiwkvmeecierglkaegvlpGglkvkrraaslkrklkakeets.............kdpla 258 +++ +l+ + vm++ci rg+++ g+lpGgl+v rra l+++l k+e s + lcl|FitnessBrowser__Pedo557:CA265_RS21785 208 TKKGILQHFAVMSDCIYRGCHTTGFLPGGLNVARRAFPLNKRLIGKSEYSdynswveairkggNGFNY 275 *******************************************9877765442222111111122345 PP TIGR00720 259 vldwvnlyalavneenaaGgrvvtaPtnGaagiiPavlayykkfveeaseekvvrflltagaiGilyk 326 +ldwv+ +alavneena+ grvvtaPtnGaag+iPavl+y+ +f++ seek+++f+ a+ iG+++k lcl|FitnessBrowser__Pedo557:CA265_RS21785 276 TLDWVSCFALAVNEENASFGRVVTAPTNGAAGVIPAVLQYFITFCDGYSEEKIMQFIACASEIGSIFK 343 79****************************************************************** PP TIGR00720 327 enasisgaevGCqgevGvacsmaaaglaellggtpeqvenaaeiamehnlGltCdPvgGlvqiPCier 394 + a+is+a GCq+e+Gv+++maaa+l+e lgg+++qv +aaeiameh+lGltCdP+gGlvqiPCier lcl|FitnessBrowser__Pedo557:CA265_RS21785 344 KGATISAAMGGCQAEIGVSSAMAAAALTECLGGSQRQVLMAAEIAMEHHLGLTCDPIGGLVQIPCIER 411 ******************************************************************** PP TIGR00720 395 naiaavkainaarlalkedg.kkkvsldkvietmretGkdmkakyketskgGlavkv 450 n+++a+kai a++lal+++ k kvsld v++tm et dm+akykets gGla+++ lcl|FitnessBrowser__Pedo557:CA265_RS21785 412 NTMGAIKAITASQLALQSNPdKAKVSLDAVVNTMWETALDMNAKYKETSDGGLATNI 468 *****************997589*******************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (450 nodes) Target sequences: 1 (475 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.36 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory