Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate CA265_RS00760 CA265_RS00760 2-deoxy-D-gluconate 3-dehydrogenase
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Pedo557:CA265_RS00760 Length = 254 Score = 145 bits (366), Expect = 8e-40 Identities = 97/260 (37%), Positives = 132/260 (50%), Gaps = 30/260 (11%) Query: 12 DLFRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGT------ 65 ++F L G+ ALVTG +GIG +A LA+AGA + +G A+ EL G+ Sbjct: 3 NIFNLAGKTALVTGCKRGIGKAMALALAEAGADI--------IGVSASLELQGSAVEKEI 54 Query: 66 -------------FERLNVTDADAVADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRA 112 F + T A A A + P +D+LVNNAG + P + D+ W Sbjct: 55 LALGRKFYAYQCDFGKRENTLAFA-AQVKADHPVIDILVNNAGTILRQPIAEHSDEYWDE 113 Query: 113 VLSVNLDGVFWCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTR 172 V++VN F RE GR M+ARG G ++ TAS+ P Y ASK A+ LT+ Sbjct: 114 VIAVNQTAPFILTREIGREMIARGSGKVIFTASLLSFQGGITVP--GYAASKGAIASLTK 171 Query: 173 SLAGEWASRGVRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLY 232 + A EWAS+GV VNA+APGY AT T E + + L P GR P + L+ Sbjct: 172 AFANEWASKGVNVNAIAPGYIATDNTSALREDQDRSTSILSRIPAGRWGTPEDFKGPTLF 231 Query: 233 LASDAASFVTGHTLVVDGGY 252 LAS A+ +V G L VDGG+ Sbjct: 232 LASPASDYVHGTILTVDGGW 251 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 254 Length adjustment: 24 Effective length of query: 231 Effective length of database: 230 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory