Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate CA265_RS08355 CA265_RS08355 short-chain dehydrogenase
Query= reanno::WCS417:GFF2259 (257 letters) >FitnessBrowser__Pedo557:CA265_RS08355 Length = 254 Score = 128 bits (322), Expect = 1e-34 Identities = 88/256 (34%), Positives = 128/256 (50%), Gaps = 11/256 (4%) Query: 1 MKRLEGKSALITGSARGIGRAFAQAYIAEGATVAIADIDLQRAQATAAEL---GPQAYAV 57 M L+ K A++TG GIG+A A +GA V I ++ + AQ T E+ G A++ Sbjct: 1 MFSLKNKKAVVTGGGSGIGKAIATILAKQGAEVHIIELGTEHAQDTLDEIKTNGGVAFSY 60 Query: 58 AMDVTDQASIDGAITAVVAQAGKLDILINNAALFDLAPIVDITRDSYDRLFSINVAGTLF 117 DV+D A+ AV + G ++ILINNA + + +DR+ +NV G Sbjct: 61 GCDVSDHQ----AVAAVFNEIGNINILINNAGIAHIGKADTTDEADFDRVMRVNVKGVYN 116 Query: 118 TLQAAARQMIRQGHGGKIINMASQAGRRGEPLVAIYCATKAAVISLTQSAGLNLIKQGIN 177 L AA Q IR GG IINMAS A G P +Y A K AV ++T S + I + I Sbjct: 117 CLHAAIPQ-IRLSGGGVIINMASIAALIGLPDRFVYSAAKGAVKAITMSVAKDYIGENIR 175 Query: 178 VNAIAPGVVDGEHWDGVDALFAKHEGLAPGEKKQRVGAEVPFGRMGTAEDLTGMAIFLAS 237 N+I+P V H VD K+ E +++ P GRM E++ +A++L S Sbjct: 176 CNSISPARV---HTPFVDGFLQKNYPDNIPEMFEKLSKTQPIGRMAKPEEVGALALYLCS 232 Query: 238 KEADYVVAQTYNVDGG 253 EA ++ Y +DGG Sbjct: 233 DEASFITGCDYPIDGG 248 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 254 Length adjustment: 24 Effective length of query: 233 Effective length of database: 230 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory