Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate CA265_RS15450 CA265_RS15450 3-oxoacyl-[acyl-carrier-protein] reductase
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Pedo557:CA265_RS15450 Length = 247 Score = 138 bits (347), Expect = 1e-37 Identities = 85/246 (34%), Positives = 133/246 (54%), Gaps = 14/246 (5%) Query: 16 LDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNP-DVGEGAARELDGTFERLNVTDA 74 L+G+ ALVTG ++GIG +IA A+ GA V L+ + GE +EL ++ + Sbjct: 4 LEGKTALVTGASKGIGRKIAEKFAEQGANVAFTYLSSVEKGEALEQELQSFGTKVKGYRS 63 Query: 75 DA---------VADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCC 125 DA + D+ +D++VNNAGI ++ +++W V+++NL +F Sbjct: 64 DASKFAEAEQLINDIVAEFGTIDIVVNNAGITKDGLLMRMSEENWDDVININLKSIFNVT 123 Query: 126 REFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRV 185 + + M+ +G ++ S+ G N Q A Y ASKA +I T+S+A E SR +R Sbjct: 124 KAASKVMMKARKGVFINMGSIVGTTGNGGQ--ANYAASKAGIIGFTKSIAKELGSRNIRA 181 Query: 186 NAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHT 245 N VAPG+ T +T + P+ E W K+ PL R E +IA ++LASD +++VTG T Sbjct: 182 NVVAPGFIRTEMT--DILDPKVVEGWEKDIPLKRAGETEDIANVCVFLASDMSAYVTGQT 239 Query: 246 LVVDGG 251 L V GG Sbjct: 240 LSVCGG 245 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 247 Length adjustment: 24 Effective length of query: 231 Effective length of database: 223 Effective search space: 51513 Effective search space used: 51513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory