Align Sorbitol-6-phosphate 2-dehydrogenase; EC 1.1.1.140; Glucitol-6-phosphate dehydrogenase; Ketosephosphate reductase (uncharacterized)
to candidate CA265_RS04665 CA265_RS04665 short-chain dehydrogenase
Query= curated2:P37079 (267 letters) >FitnessBrowser__Pedo557:CA265_RS04665 Length = 260 Score = 102 bits (253), Expect = 1e-26 Identities = 80/269 (29%), Positives = 126/269 (46%), Gaps = 30/269 (11%) Query: 5 LNLKDNVIIVTGGASGIGLAIVDELLSQGAHVQMIDIHGGDRHHN-------GDNYHFWS 57 LNL +I+V+GGA GIG AIV L + A +I + D G +++ Sbjct: 3 LNLDGKIILVSGGAKGIGAAIVKALAIENAFPIIIGRNENDNLKMLQEITDLGLKADYFT 62 Query: 58 TDISSATEVQQTIDAIIQRWSRIDGLVNNAGVNFPRLLVDEKAPAGRYELNEAAFEKMVN 117 ++++ + +DAI+ ++ RIDGLVNNAGVN L +E + Sbjct: 63 AELTAPESCKTIVDAILAKYGRIDGLVNNAGVN------------DGVGLENGTYEGFME 110 Query: 118 INQKGV--FFMSQAVARQMVKQRAGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWS 175 K V +++ A +KQ G I+N+ S++ G G S YAA+ A N+ TR W+ Sbjct: 111 SLHKNVVHYYLLAKHALPALKQSKGSILNIGSKTAETGQGGTSGYAASNGARNALTREWA 170 Query: 176 KELGKYGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYTKNAIPI-GRAGK 234 EL + IRV + + E TP YE+ W + + + IP R Sbjct: 171 VELLPFSIRVNAII--VAEAW---TPLYEK---WINSFEDRDEKLKNITDKIPFENRMTS 222 Query: 235 LSEVADFVCYLLSARASYITGVTTNIAGG 263 + E+A +LLS ++S+ TG ++ GG Sbjct: 223 VDEIASMAVFLLSDKSSHTTGQLIHVDGG 251 Lambda K H 0.316 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 260 Length adjustment: 25 Effective length of query: 242 Effective length of database: 235 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory