Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate CA265_RS08355 CA265_RS08355 short-chain dehydrogenase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Pedo557:CA265_RS08355 Length = 254 Score = 103 bits (256), Expect = 5e-27 Identities = 84/270 (31%), Positives = 131/270 (48%), Gaps = 32/270 (11%) Query: 6 NLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKH--------QSSGNYNF-W 56 +LK K VTGG SGIG AI L QGA V +I++ G +H +++G F + Sbjct: 3 SLKNKKAVVTGGGSGIGKAIATILAKQGAEVHIIEL--GTEHAQDTLDEIKTNGGVAFSY 60 Query: 57 PTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYEL-NEAAFEKM 115 D+S H+ V + G I+ L+NNAG+ A G+ + +EA F+++ Sbjct: 61 GCDVSD----HQAVAAVFNEIGNINILINNAGI----------AHIGKADTTDEADFDRV 106 Query: 116 VNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWS 175 + +N KGV+ A Q+ GVI+N++S + L G + Y+A K A+ + T S + Sbjct: 107 MRVNVKGVYNCLHAAIPQIRLSGGGVIINMASIAALIGLPDRFVYSAAKGAVKAITMSVA 166 Query: 176 KELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRL 235 K+ IR ++P + TP + L + ++ E SK P+GR + Sbjct: 167 KDYIGENIRCNSISP-----ARVHTPFVDGFLQKNYPDNIPEMFEKLSKTQ-PIGRMAKP 220 Query: 236 TEVADFVCYLLSERASYMTGVTTNIAGGKT 265 EV YL S+ AS++TG I GG T Sbjct: 221 EEVGALALYLCSDEASFITGCDYPIDGGFT 250 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 254 Length adjustment: 24 Effective length of query: 243 Effective length of database: 230 Effective search space: 55890 Effective search space used: 55890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory