Align ABC transporter (characterized, see rationale)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 151 bits (382), Expect = 2e-41 Identities = 87/230 (37%), Positives = 137/230 (59%), Gaps = 9/230 (3%) Query: 11 KQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVN-- 68 +Q GG +++VS EI G+ V +G SG GKSTLL+ I GL G++ + +RV Sbjct: 18 EQAGG---IKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTDEGEIFFEDKRVKGP 74 Query: 69 --DLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDKL 126 L P + + MV Q ++L + VYDNI+ +L+ TD + E+ L+ + L++ L Sbjct: 75 DEQLIPGHKQMKMVTQDFSLNIYAKVYDNIAS--QLSNTDLKTKAEKTLQIMEHLRILPL 132 Query: 127 LQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGST 186 +K ELSGG++QRVA+ +AM + +LL DEP S +DA L+ Q+R +I R+ G T Sbjct: 133 QNKKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQLRADIKRVASETGVT 192 Query: 187 MIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGS 236 +I V+HD + + LAD++++L G + Q G P E+Y+ P + A LG+ Sbjct: 193 VILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTAQILGN 242 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 330 Length adjustment: 29 Effective length of query: 352 Effective length of database: 301 Effective search space: 105952 Effective search space used: 105952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory