Align L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (characterized)
to candidate CA265_RS08335 CA265_RS08335 alpha-hydroxy-acid oxidizing enzyme
Query= reanno::Smeli:SM_b20850 (378 letters) >FitnessBrowser__Pedo557:CA265_RS08335 Length = 389 Score = 241 bits (614), Expect = 3e-68 Identities = 131/370 (35%), Positives = 208/370 (56%), Gaps = 2/370 (0%) Query: 3 QILEIRDLKALARRRVPKLFFDYADSGAWTEGTYRANEEDFAGIKLRQRVLVDMSDRSLE 62 Q + DL+ A+ R+PK FDY + G NE DF I L+ L D + Sbjct: 12 QFPSVADLRKKAKSRIPKFAFDYLEGGCNEGLNLSRNESDFDNIYLKPNYLRVGGDIDMS 71 Query: 63 TTMIGQKVSMPVALAPTGLTGMQHADGEMLAAQAAEAFGVPFTLSTMSICSIEDVASVTT 122 + G++ S P ++P GL G+ + + A+AA +P+TLST+S SIE +A V+ Sbjct: 72 VELFGRRYSAPFGISPIGLQGLMWPNAPEILARAAAKADIPYTLSTVSTSSIERIAEVSE 131 Query: 123 KPFWFQLYVMREREFVLDLIDRAKAAKCSALVMTLDLQILGQRHKDLRNGLSAPPRLTPK 182 WFQLY E D+++R KA +C LV+ +D+ G R+K++++GLS PP+++ Sbjct: 132 GKAWFQLYHPTEDRLRDDILNRLKAVECPVLVVLVDVPAFGLRYKEIKSGLSIPPKMSIN 191 Query: 183 HLWMMATRPGWCMKMLGTNRRTFRNIVGHAKSVADLSSLQAWTNEQFDPQLSWKDVEWIK 242 ++ RP W +K L +F + + + D+S L + N F ++ + V I+ Sbjct: 192 NILQAFARPLWGIKTLQHGIPSFATLKPYMEKGMDMSQLGQFMNRTFTGKVDIEKVSAIR 251 Query: 243 ERWGGPLILKGILDPEDAKMAAKTGADAIIVSNHGGRQLDGAHSSISMLPRIVE--AVGD 300 + W GPLILKGI ED + A + GAD +IVSNHGGRQ+D SSI+ L ++ Sbjct: 252 DLWKGPLILKGITTDEDMQAAIQIGADGVIVSNHGGRQIDAGESSINSLIKMTNNPIYKS 311 Query: 301 QIEVHLDGGIRSGQDVLKAIALGAKGTYIGRPFLYGLGALGKEGVTLALDIIRKEMDTTM 360 ++++ LDGGIRSG D+ +A A+G++ ++GRPF+YG+GALG EG +++ + + M Sbjct: 312 KLKIMLDGGIRSGVDLARAHAVGSEFNFMGRPFMYGVGALGNEGGDHTINMFKTHLYQIM 371 Query: 361 ALCGKRRITE 370 +IT+ Sbjct: 372 QQLTIEKITQ 381 Lambda K H 0.321 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 389 Length adjustment: 30 Effective length of query: 348 Effective length of database: 359 Effective search space: 124932 Effective search space used: 124932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory