Align 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase; AONS/AKB ligase; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Alpha-oxoamine synthase; Glycine acetyltransferase; EC 2.3.1.29; EC 2.3.1.47 (characterized)
to candidate CA265_RS13580 CA265_RS13580 8-amino-7-oxononanoate synthase
Query= SwissProt::Q5SHZ8 (395 letters) >FitnessBrowser__Pedo557:CA265_RS13580 Length = 401 Score = 277 bits (709), Expect = 3e-79 Identities = 142/378 (37%), Positives = 221/378 (58%), Gaps = 1/378 (0%) Query: 16 LKREGLYISPKVLEAPQEPVTRVEGREVVNLASNNYLGFANHPYLKEKARQYLEKWGAGS 75 +K +GLY + +E+ Q+ + G++V+ SN+YLG NHP +KE A+ +EK+G G Sbjct: 18 IKEKGLYPYFRSIESGQDTEVVINGKKVLMFGSNSYLGLTNHPKIKEAAKAAIEKYGTGC 77 Query: 76 GAVRTIAGTFTYHVELEEALARFKGTESALVLQSGFTANQGVLGALLKEGDVVFSDELNH 135 R + G+ H+ELE LA + G E+A++ +GF N GV+ LL D + DE +H Sbjct: 78 AGSRFLNGSLDIHLELENRLAEYVGKEAAVLFSTGFQVNLGVISCLLDRNDYLLLDEYDH 137 Query: 136 ASIIDGLRLTKATRLVFRHADVAHLEELLKAHDTDGLKLIVTDGVFSMDGDIAPLDKIVP 195 ASIIDG RL + + + H D+ L L D KLIV+DG+FSM+GD+ L ++V Sbjct: 138 ASIIDGSRLAFSRTIKYAHNDMQDLRRKLSRLPEDSAKLIVSDGIFSMEGDLVNLPEMVD 197 Query: 196 LAKKYKAVVYVDDAHGSGVLGEKGKGTVHHFGFHQDPDVVQVATLSKAWAGIGGYAAGAR 255 +A ++ A + +DDAH GV+G G GT HF +D D++ + T SK+ A +GG+ AG+ Sbjct: 198 IANEFGANIMMDDAHSLGVIGFNGSGTASHFNLTEDVDLI-MGTFSKSLASLGGFIAGST 256 Query: 256 ELKDLLINKARPFLFSTSHPPAVVGALLGALELIEKEPERVERLWENTRYFKRELARLGY 315 E + + ++AR +FS S PP+ V +++ AL++IE EPER+++LW NT Y K+ L G+ Sbjct: 257 ETIEYIKHRARSLMFSASMPPSAVASVIAALDIIESEPERIDKLWANTEYAKKLLLEAGF 316 Query: 316 DTLGSQTPITPVLFGEAPLAFEASRLLLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTKE 375 D S +PI PV + F + +L + GVF + P VP + IR + A HT E Sbjct: 317 DIGHSNSPIIPVYIRDNIKTFMITNILQQNGVFVNPVVSPAVPSDSSLIRFSLMATHTFE 376 Query: 376 MLDKALEAYEKVGKRLGI 393 ++ A+ K + + Sbjct: 377 QIESAIAKLSAAFKAVNV 394 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 401 Length adjustment: 31 Effective length of query: 364 Effective length of database: 370 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory