Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate CA265_RS15335 CA265_RS15335 NAD-dependent epimerase
Query= reanno::Cup4G11:RR42_RS28300 (324 letters) >FitnessBrowser__Pedo557:CA265_RS15335 Length = 314 Score = 338 bits (867), Expect = 1e-97 Identities = 167/309 (54%), Positives = 214/309 (69%), Gaps = 3/309 (0%) Query: 6 RVLIIGANGQLGTELASALADRYGKQNVVTSDMVPHGRHLHLT--HEMLDVTDRAHLRDV 63 +++++G+NGQ+GTEL + L YG +VV D+ + + E ++V D+ + + Sbjct: 4 KIVVLGSNGQIGTELVTMLRKIYGDDHVVACDIRRPDYDIKNSAPFEFVNVLDKEMINGI 63 Query: 64 IERHGITQIYHLAAALSATGEKSPTWAWQLNMNGLLNVLEAARHQKLDKVFWPSSIAAFG 123 ++ TQ+Y LAA LSATGE++P AW LNMNGLLNVL+ A K KV+WPSSIA FG Sbjct: 64 FHKYRPTQVYLLAALLSATGEQNPKLAWDLNMNGLLNVLDLALEYKTAKVYWPSSIAVFG 123 Query: 124 PTTPPDGTPQSTIMEPKTVYGISKLAGEGWCRWYFENHGVDVRSLRYPGLISYKTPPGGG 183 P +P D T Q +M+P TVYGISKLAGE WC +Y + +G+DVRS+RYPGLIS+K PGGG Sbjct: 124 PNSPKDNTSQYCVMDPNTVYGISKLAGERWCEYYNQKYGLDVRSIRYPGLISWKAAPGGG 183 Query: 184 TTDYAIDIFHSALRAQPYACFLEKDEALPMMYMPDAVRATMELMEAPRASISERGSYNLA 243 TTDYAI IFH AL+ Y FL D LPMMYM DA+R T+ELM+AP IS R SYN Sbjct: 184 TTDYAIHIFHDALKKGSYQSFLSADTELPMMYMDDAIRGTIELMDAPADQISVRSSYNFG 243 Query: 244 GLSFTPGEIANEIRRHCPGFDVRY-EPDFRQEIAAGWPDSIDDSVARRDWNWRPEFGLKE 302 G+SFTP +A EIR+H P F + Y D RQ+IA WP SIDD+ A +DW W+PEF L + Sbjct: 244 GVSFTPEVLAAEIRKHIPEFTLTYGANDPRQQIANSWPRSIDDNYAAKDWGWKPEFDLSK 303 Query: 303 MVADMLKNL 311 + ADMLKNL Sbjct: 304 LTADMLKNL 312 Lambda K H 0.319 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 314 Length adjustment: 28 Effective length of query: 296 Effective length of database: 286 Effective search space: 84656 Effective search space used: 84656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory