Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate CA265_RS00430 CA265_RS00430 2,5-diketo-D-gluconic acid reductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Pedo557:CA265_RS00430 Length = 283 Score = 263 bits (671), Expect = 4e-75 Identities = 134/258 (51%), Positives = 181/258 (70%), Gaps = 3/258 (1%) Query: 7 DTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKE 66 +TVKL+NG+EMP G GVF+V + E SV AI GYR IDTAA Y NEE VG IK Sbjct: 2 ETVKLNNGIEMPLLGFGVFQVTDLAECERSVLDAIDTGYRLIDTAASYMNEEAVGQAIKN 61 Query: 67 SGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRAL 126 S V RE LF+T+K+W + GY T AFE SL++L+LDYLDLYLIH P D Y + WRA+ Sbjct: 62 SHVPREALFVTTKLWIQSNGYTNTKKAFEASLKKLKLDYLDLYLIHQPYGDVYGE-WRAM 120 Query: 127 EKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQL 186 E+LYK+GK+RAIGVSNF L +L+ EI P VNQ+E HP Q + + + +Q+ Sbjct: 121 EELYKEGKVRAIGVSNFHPDRLADLIIHNEITPAVNQIETHPFHQQLDTQRFLNENKVQI 180 Query: 187 EAWSPLMQGQ--LLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENAD 244 E+W P +G+ + ++E+L IA ++NKSVAQVILRW +Q GVV IPKS+++ R+ EN + Sbjct: 181 ESWGPFAEGKHNIFNDELLLAIASQYNKSVAQVILRWLIQRGVVAIPKSVRKERMAENLN 240 Query: 245 IFDFELSQEDMDKIDALN 262 +FDF+LS +DM+ I +++ Sbjct: 241 VFDFKLSDDDMNSIKSMD 258 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 283 Length adjustment: 26 Effective length of query: 250 Effective length of database: 257 Effective search space: 64250 Effective search space used: 64250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory