GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Pedobacter sp. GW460-11-11-14-LB5

Align Alcohol dehydrogenase; EC 1.1.1.1; EC 1.1.1.4; EC 1.2.1.3 (characterized)
to candidate CA265_RS12005 CA265_RS12005 glutathione-dependent formaldehyde dehydrogenase

Query= SwissProt::Q0KDL6
         (366 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS12005 CA265_RS12005
           glutathione-dependent formaldehyde dehydrogenase
          Length = 385

 Score =  192 bits (489), Expect = 1e-53
 Identities = 137/402 (34%), Positives = 207/402 (51%), Gaps = 58/402 (14%)

Query: 5   MKAAVFVEPGRIELADKPIPDI-GPNDALVRITTTTICGTDVHILKGEYPVAKGLTVGHE 63
           MKAAVF +PG I +   P P I  P D ++++T+T ICG+D+HIL G  P    L +GHE
Sbjct: 1   MKAAVFHKPGDIRVDYVPDPKILDPRDVILKVTSTAICGSDLHILSGAVPQKDPLIMGHE 60

Query: 64  PVGIIEKLGSAVTGYREGQRVI----------------AGAICP--NFNSYAAQDGVASQ 105
            +GI+E++G+++T  + G RV+                A   C   NF +Y     + SQ
Sbjct: 61  FMGIVEEVGASITNLKRGDRVVVPFPISCGKCFFCTHEASPACETSNFKNYGPNGDMMSQ 120

Query: 106 DGSYLMASGQCGCHGYKATAGWRFGNMIDGTQAEYVLVPDAQANLTPIPDGLTDEQVLMC 165
            G+ L         GY    G        G QA+YV VP A  +   +P+ L+DEQ L  
Sbjct: 121 KGAALF--------GYTDLYGG-----YSGGQAQYVRVPYADISPRIVPEHLSDEQALFL 167

Query: 166 PDIMSTGFKGAENANIRIGDTVAVFAQGPIGLCATAGARLCGATTIIAIDGNDHRLEIAR 225
            DI  TG+   + A ++ G+ VA+F  GP+GL A   A + GA+ +IAID  D+RLE A+
Sbjct: 168 TDIFPTGWSAIDWAQLKGGEVVAIFGSGPVGLMAQKAAWINGASRVIAIDPLDYRLEKAK 227

Query: 226 KMGADVVLNFRNCDVVDEVMKLTGGRGVDASIEALG----------TQAT--FEQ-SLRV 272
            +    +LN    DVV+ + ++TGGRG D  ++A+G           +AT  FE+ S++V
Sbjct: 228 AVNNVDILNPHKVDVVEAIREMTGGRGADLCVDAVGFEPERSFFDKVKATVHFEKGSIKV 287

Query: 273 L-------KPGGTLSSLGVYSSDL-TIPL-SAFAAGLGDHKINTALCPGGKERMRRLINV 323
           L       +  GT+S +GVY S     PL   F  G+    I     P     + +LI +
Sbjct: 288 LEMCFEAVRRMGTVSIMGVYGSPYDNFPLFRIFDKGI---TIKQGQAP-VLNYIDKLIGL 343

Query: 324 IESGRVDLGALVTHQYRLDDIVAAYDLFANQRDGVLKIAIKP 365
           +  G+V L  ++TH   L+D    Y +F N+ +  +K+ +KP
Sbjct: 344 VNEGKVVLDDIITHTLPLEDAAHGYKIFDNKEEDCVKVVLKP 385


Lambda     K      H
   0.320    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 386
Number of extensions: 23
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 366
Length of database: 385
Length adjustment: 30
Effective length of query: 336
Effective length of database: 355
Effective search space:   119280
Effective search space used:   119280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory