GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Pedobacter sp. GW460-11-11-14-LB5

Align Aldehyde dehydrogenase; Acetaldehyde dehydrogenase; EC 1.2.1.3 (characterized)
to candidate CA265_RS14635 CA265_RS14635 aldehyde dehydrogenase

Query= SwissProt::A1B4L2
         (508 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS14635 CA265_RS14635 aldehyde
           dehydrogenase
          Length = 501

 Score =  686 bits (1771), Expect = 0.0
 Identities = 330/492 (67%), Positives = 397/492 (80%)

Query: 17  FEERYDNFIGGEWVAPVSGRYFTNTTPITGAEIGQIARSEAGDIELALDAAHAAKEKWGA 76
           F+ +YDN+IGG++VAPV G YF N +PI G    + A S   D+ELA+DAAH A + W  
Sbjct: 10  FKPQYDNYIGGKFVAPVKGAYFDNISPIDGKVFTKAAHSTKEDLELAVDAAHEAFKTWSK 69

Query: 77  TSPAERANIMLKIADRMERNLELLATAETWDNGKPIRETMAADLPLAIDHFRYFAGVLRA 136
           TS  ER+ I+ KIA RME NLE LA  ET DNGK +RET+AADLPL +DHFRYFAGV+RA
Sbjct: 70  TSSTERSIILNKIAQRMEDNLEYLAAVETIDNGKAVRETLAADLPLGVDHFRYFAGVIRA 129

Query: 137 QEGSISQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPAIAAGNCVVLKPAEQTP 196
           +EGS+S++D +TV+   HEP+GVV QIIPWNFPLLM  WKLAPA+AAGNCVVLKPAE TP
Sbjct: 130 EEGSLSELDQNTVSLIVHEPIGVVAQIIPWNFPLLMGIWKLAPALAAGNCVVLKPAESTP 189

Query: 197 AGIMVWANLIGDLLPPGVLNIVNGFGLEAGKPLASSNRIAKIAFTGETTTGRLIMQYASE 256
             IMV   LIGDLLPPGV+N+VNGFG E G+ L ++ +++K AFTG T TGRL+MQYA+E
Sbjct: 190 VSIMVLMELIGDLLPPGVVNVVNGFGSELGRALVTNPKVSKAAFTGSTPTGRLVMQYATE 249

Query: 257 NLIPVTLELGGKSPNIFFADVAREDDDFFDKALEGFTMFALNQGEVCTCPSRVLIQESIY 316
           N+IPVTLELGGKSPNIFF+ V  EDD F DKA+EG  MFALNQGE+CTCPSR+LIQE IY
Sbjct: 250 NIIPVTLELGGKSPNIFFSSVMAEDDAFLDKAVEGAVMFALNQGEICTCPSRLLIQEDIY 309

Query: 317 DKFMERAVQRVQAIKQGDPRESDTMIGAQASSEQKEKILSYLDIGKKEGAEVLTGGKAAD 376
           +KF+ + ++R +AIK G P +   M+GAQAS  Q EKI +Y+ +GK+EGAEVLTGG+  +
Sbjct: 310 EKFIAKVIERTKAIKIGSPLDRTVMMGAQASKIQFEKIAAYIKLGKEEGAEVLTGGEINE 369

Query: 377 LGGELSGGYYIEPTIFRGNNKMRIFQEEIFGPVVSVTTFKDQAEALEIANDTLYGLGAGV 436
           L GEL GGYYI+PTIF+G+NKMRIFQEEIFGPV++VTTFK   EA+EIANDTLYGLGAGV
Sbjct: 370 LPGELGGGYYIKPTIFKGHNKMRIFQEEIFGPVLAVTTFKTVEEAIEIANDTLYGLGAGV 429

Query: 437 WSRDANTCYRMGRGIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNM 496
           W+RDA+  Y++ R I+AGRVW N YHAYPA A FGGYKQSG+GRE HKMML HY+QTKNM
Sbjct: 430 WTRDAHELYQVPRAIQAGRVWVNQYHAYPAGAPFGGYKQSGVGRENHKMMLGHYRQTKNM 489

Query: 497 LVSYSPKKLGFF 508
           L+SY   KLGFF
Sbjct: 490 LISYDKNKLGFF 501


Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 809
Number of extensions: 24
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 508
Length of database: 501
Length adjustment: 34
Effective length of query: 474
Effective length of database: 467
Effective search space:   221358
Effective search space used:   221358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory