GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Pedobacter sp. GW460-11-11-14-LB5

Align Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 (characterized)
to candidate CA265_RS09660 CA265_RS09660 phosphoglucomutase

Query= SwissProt::O74478
         (587 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS09660 CA265_RS09660
           phosphoglucomutase
          Length = 578

 Score =  300 bits (767), Expect = 1e-85
 Identities = 196/565 (34%), Positives = 294/565 (52%), Gaps = 19/565 (3%)

Query: 1   MDPILQELVDEWFKLDQDETTRNEVSQLIKAEDYATLKQIMHPRIGFGTSGLRAEIGAGF 60
           +D   Q  +++W   + DE T+ E+  L+  +    L    +  + FGT GLR  +GAG 
Sbjct: 4   IDQSTQATINQWLSGNYDENTKAEIQALVDKDATTELTDAFYRSLEFGTGGLRGIMGAGS 63

Query: 61  ARMNCLTVIQASQGFAEYLLQTVPSAAKLGVVIGHDHRHKSNTFARLTAAVFLQKGFKTY 120
            R+N  T+  A+QG A YL    P+  K+ V I HD R+ S+ FA++TA VF   G   Y
Sbjct: 64  NRINKYTIGTATQGLANYLNNKYPNE-KIKVAIAHDSRNNSDYFAKITADVFSANGIHVY 122

Query: 121 FFDHLVHTPLVPFAVKTLGTAAGVMITASHNPAAYNGYKVYWGNGCAIIPPHDKGIAACI 180
           FF  L  TP + FAV+  G  +GVM+TASHNP  YNGYK Y  +G     P DK +   +
Sbjct: 123 FFSALRPTPELSFAVRHFGCKSGVMLTASHNPKEYNGYKAYGADGGQFTSPDDKLVIDEV 182

Query: 181 E--KNLTPITWDKNLVENHKLADRDFAVGLLKNYWSQLHEFHSENNFSLEMKSLKFVYTP 238
              KN+  + +D+ +  N +L   +    + K Y   +               LK VY+P
Sbjct: 183 NKIKNIDEVKFDR-VEANIELIGEE----VDKLYLDGITALSISPEAIKRQHDLKIVYSP 237

Query: 239 IHGVGLPFVTSALHLFGEQGDMISVPLQDSPNPDFPTVKFPNPEEEGALDLAYEQADANG 298
           IHG G+  V  AL  FG   ++  V  Q +P+ +FPTV +PNPEE+ AL LA  +A    
Sbjct: 238 IHGTGITLVPKALAQFGFT-NVTLVEEQSTPDGNFPTVVYPNPEEKDALTLAMNKAKEID 296

Query: 299 ISYVLATDPDADRFAFAEK-INGAWRRFTGDEVGCILAYFIFQEYKNVGKPIDDFYVLST 357
              VLATDPDADR   A K  NG W    G++ GC+L  ++   ++  GK   + +++ T
Sbjct: 297 ADLVLATDPDADRVGIAVKDNNGEWVLLNGNQTGCLLINYLLSAWEANGKLDGNQFIVKT 356

Query: 358 TVSSAMVKSMAKVEGFHHVETLTGFKWLGNKALELEKQGKFIGLAYEEALGYMVGSIVRD 417
            V+S +++ +AK +   +  TLTGFK++G    ELE +  FIG   EE+ GY++G +VRD
Sbjct: 357 IVTSNLIEEIAKKKDVTYYNTLTGFKYIGQLMTELEGKKYFIG-GGEESYGYLIGDLVRD 415

Query: 418 KDGVNALITFLHLLKRLQLQNLSITEVFEQMSKKYGYYTTQNSYFLSRDTPKLRALVDAL 477
           KD V +      +    + +  S+      M  +YG Y       L   T K ++  + +
Sbjct: 416 KDAVVSAAFISEMTAYYKDKGASLYNALLDMYVEYGLYKED----LVSLTKKGKSGAEEI 471

Query: 478 RHYDTK--SGYPATLGSKKITNVRDLTTGYDSSSTDGKATLPVSKSSDNVTFELENGEVI 535
           +    K     PATLG  K++ ++D     ++  T GK +     +SD + F  E+G ++
Sbjct: 472 KAMMVKFRENPPATLGGSKVSVLKDYELSQETDLTTGKVSKLDYPTSDVLQFITEDGSIV 531

Query: 536 MTIRTSGTEPKLKFYICARGHSLED 560
            + R SGTEPK+KFY C+    L D
Sbjct: 532 -SARPSGTEPKIKFY-CSVNAPLAD 554


Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 808
Number of extensions: 48
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 587
Length of database: 578
Length adjustment: 36
Effective length of query: 551
Effective length of database: 542
Effective search space:   298642
Effective search space used:   298642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory