GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupG in Pedobacter sp. GW460-11-11-14-LB5

Align nucleoside permease nupG (characterized)
to candidate CA265_RS08855 CA265_RS08855 MFS transporter

Query= CharProtDB::CH_088596
         (418 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS08855 CA265_RS08855 MFS
           transporter
          Length = 459

 Score =  409 bits (1052), Expect = e-119
 Identities = 206/451 (45%), Positives = 293/451 (64%), Gaps = 44/451 (9%)

Query: 1   MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGI 60
           MN+K +L I+SF+QF +W +WL T+ +Y F T ++DGA  G ++S++GIA++FMP + GI
Sbjct: 1   MNVKFRLTIMSFMQFFVWAAWLITIANYWFGTKQWDGADFGIIFSTMGIASLFMPTITGI 60

Query: 61  VADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYR 120
           +ADKW++A+ +YAI H + A T+F   QV  P   F VIL+    YMPT+ L N+ISY  
Sbjct: 61  LADKWINAERLYAILHILYAATMFYLPQVEDPHTFFWVILVAMCFYMPTIALSNSISYTT 120

Query: 121 LQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLYIGAALSAILVLFTLTLP 180
           L+N   D+V +FPPIR+WGT+GFI AMW+ +L+G + S  Q YI    + +L L++ TLP
Sbjct: 121 LKNGNFDVVKNFPPIRVWGTVGFIAAMWLTNLTGNKASANQFYIAGVSALMLGLYSFTLP 180

Query: 181 HI-PVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNTFLHSFD 239
              P+      +++   LGL++F LF + +MA+FFIFSM LGA LQ+TN +G+ FL  F 
Sbjct: 181 ACKPLNLISEKKTFAQKLGLESFKLFADYKMALFFIFSMFLGAALQLTNAYGDVFLDEFK 240

Query: 240 KDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFA 299
             P+FA SF++++++II+SISQISETLFIL IPFFL R+GIK V+ I++ AW+LRF LFA
Sbjct: 241 LFPVFAESFVIRYSTIILSISQISETLFILAIPFFLKRFGIKWVIAIAMFAWVLRFGLFA 300

Query: 300 YGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCI 359
           +GDP+     +++ S IVYG AFDFFNISGS+FVE   +P  R+SAQG+F+MMTNGFG +
Sbjct: 301 FGDPST-NLWMIITSCIVYGMAFDFFNISGSLFVETSTTPKTRSSAQGLFMMMTNGFGAV 359

Query: 360 LGGIVSGKVVEMY-----------------------------------TQNG-------I 377
            G +VSG ++  Y                                    +NG       +
Sbjct: 360 FGSLVSGWMINKYFTTYYSSIDSLSKYVKSEADNKHLLQFLKNKGISVLENGNLSRALDV 419

Query: 378 TDWQTVWLIFAGYSVVLAFAFMAMFKYKHVR 408
            DW  +WL F  Y +V+A  F+ +FK+KH R
Sbjct: 420 KDWHNIWLSFTIYVLVIAIVFVVIFKHKHTR 450


Lambda     K      H
   0.331    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 696
Number of extensions: 40
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 418
Length of database: 459
Length adjustment: 32
Effective length of query: 386
Effective length of database: 427
Effective search space:   164822
Effective search space used:   164822
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory