GapMind for catabolism of small carbon sources

 

Aligments for a candidate for SSS-glucose in Pedobacter sp. GW460-11-11-14-LB5

Align Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized)
to candidate CA265_RS19720 CA265_RS19720 sodium transporter

Query= SwissProt::P96169
         (543 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS19720 CA265_RS19720 sodium
           transporter
          Length = 558

 Score =  504 bits (1297), Expect = e-147
 Identities = 259/557 (46%), Positives = 362/557 (64%), Gaps = 33/557 (5%)

Query: 12  DIMVFAIYVAIIIGVGLWVSRDKKGTQKSTEDYFLAGKSLPWWAVGASLIAANISAEQFI 71
           D +VFAIY  I+   GL++   KK     ++DYFLA  SL WWA+GASLIA+NISAEQFI
Sbjct: 10  DYIVFAIYFVIVAAYGLYIYNKKKSASTGSKDYFLAEGSLTWWAIGASLIASNISAEQFI 69

Query: 72  GMSGSGYSIGLAIASYEWMSAITLIIVGKYFLPIFIEKGIYTIPEFVEKRFNKKLKTILA 131
           GMSGSG+ +GLAIA+YEWM+A+TL+IV  +F+P++++  I T+P+F+ +R+N  +  I+A
Sbjct: 70  GMSGSGFKMGLAIATYEWMAALTLVIVAVFFIPVYLKNKIATMPQFLHQRYNGTVAMIMA 129

Query: 132 VFWISLYIFVNLTSVLYLGGLALETILGIPLMYSILGLALFALVYSIYGGLSAVVWTDVI 191
           VFW+ LY+ VNLTS+LYLG LA+ +I G  L + +  +A FA+V ++ GG+  + +TDVI
Sbjct: 130 VFWLLLYVVVNLTSILYLGALAVSSISGFDLTFCMYAIAAFAIVITL-GGMKVIGYTDVI 188

Query: 192 QVFFLVLGGFMTTYMAVSFIG---GTDGWFAGVSKMVDAAPGHFEMILDQSNPQYMNLPG 248
           QVFFL+LGG  TTY+A++ +    GT G F G S M   A  HF MIL   N  Y++LPG
Sbjct: 189 QVFFLILGGLATTYLALNLVSTHYGTSGIFEGYSLMTSKASEHFHMILKPDNENYIDLPG 248

Query: 249 IAVLIGGLWVANLYYWGFNQYIIQRTLAAKSVSEAQKGIVFAAFLKLIVPFLVVLPGIAA 308
           ++VL+GG+W+ NL YWG NQYI QR L A  +  A+ GI+FAAFLKL++P +VVLPGIAA
Sbjct: 249 LSVLVGGMWIVNLNYWGCNQYITQRALGA-DLKTARGGILFAAFLKLLMPIIVVLPGIAA 307

Query: 309 YVITSDPQLMASLGDIAATNLPSAANADKAYPWLTQFLPVGVKGVVFAALAAAIVSSLAS 368
           YV+  D    + +          + N D+AYP L   LP G+KG+ FAAL AA+V+SLA 
Sbjct: 308 YVLYKDGAFQSEMLQ------DGSVNPDRAYPVLLNLLPAGLKGLSFAALTAAVVASLAG 361

Query: 369 MLNSTATIFTMDIYKEYISPDSGDHKLVNVGRTAAVVALIIACLIAPMLG-GIGQAFQYI 427
             NS ATIFT+DIYK+ +  D+ +  LV  G+ A VVA+++  +IAP LG      FQYI
Sbjct: 362 KANSIATIFTLDIYKKVLKTDASEKNLVFTGKIAVVVAMVLGVVIAPYLGIDKKGGFQYI 421

Query: 428 QEYTGLVSPGILAVFLLGLFWKKTTSKGAIIGVVASIPFALFLKFMP------------- 474
           QEYTG VSPGI A+F+LG FWK+ TS  A+   V     +L LK +P             
Sbjct: 422 QEYTGFVSPGIFAMFILGFFWKRATSNAALFATVGGFGLSLLLKVLPTWTDLSWLSGMGF 481

Query: 475 --------LSMPFMDQMLYTLLFTMVVIAFTSLSTSINDDDPKGISVTSSMFVTDRSFNI 526
                     +PF+D+M +  +F ++ +   SL  + N  +PKG+ + S MF T   F +
Sbjct: 482 SVKNGVGVYEIPFLDRMGFVFVFCVIGMVIISLFENRNGVNPKGLEIDSKMFKTTTGFAV 541

Query: 527 AAYGIMIVLAVLYTLFW 543
            +  I+ +L  LY+++W
Sbjct: 542 GSLIIIGLLVALYSVYW 558


Lambda     K      H
   0.326    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1019
Number of extensions: 44
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 543
Length of database: 558
Length adjustment: 36
Effective length of query: 507
Effective length of database: 522
Effective search space:   264654
Effective search space used:   264654
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory