Align TreV, component of Trehalose porter (characterized)
to candidate CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__Pedo557:CA265_RS07485 Length = 252 Score = 124 bits (311), Expect = 2e-33 Identities = 76/220 (34%), Positives = 119/220 (54%), Gaps = 12/220 (5%) Query: 3 VELIDIVKKY--GKNIV--INGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGK 58 + + +I +KY G ++ + ++ I GEF ++GPSG GKSTL+ IL ++ G Sbjct: 6 ITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSGT 65 Query: 59 IIADGADIT----DKPPEKRN--VAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIER 112 + +G +++ D E RN + VFQ + L P + DN+A PL G K++ R Sbjct: 66 YVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPLIYAGTSKKDRDAR 125 Query: 113 VEKAAKLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTAR 172 +A + +G+ +D K ++SGGQ+QRVA+ARA++ NPS L DEP NLD + Sbjct: 126 AARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIEIM 185 Query: 173 GELKRIQKELKGTFIYVTHDQKEALSLADRIAILHKGKFE 212 G L+ I + T I VTH++ + A RI + G E Sbjct: 186 GLLEEIHSK-GNTIILVTHEE-DIAQHAHRIVRMRDGLIE 223 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 252 Length adjustment: 26 Effective length of query: 298 Effective length of database: 226 Effective search space: 67348 Effective search space used: 67348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory