Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate CA265_RS22865 CA265_RS22865 ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >FitnessBrowser__Pedo557:CA265_RS22865 Length = 583 Score = 121 bits (303), Expect = 4e-32 Identities = 80/243 (32%), Positives = 124/243 (51%), Gaps = 15/243 (6%) Query: 2 NQNQLISVEDIVFRY----RKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNG 57 N + ++D+ F A R ALD +S + + G+ +A VG +GSGKSTL + L G Sbjct: 327 NPTSIAKIKDLTFNNVGFKHLTANRNALDNISFKTHHGQTIAFVGPSGSGKSTLVKLLVG 386 Query: 58 LILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPRE 117 L + G+I GI + + +R+KIG V Q D Q T+R+++ F N E Sbjct: 387 LYPAKDGEILYNGIPSNDIDLDALREKIGFVTQ--DTQLFSGTIRENLLF--VNPNATDE 442 Query: 118 EMIERVDWAVKQV-------NMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEAT 170 E + ++ A Q + + + +SGG+KQR++IA + +PDI++ DEAT Sbjct: 443 ECYKVLNQAACQTLLARADKGLDSLIGEGGVKVSGGEKQRLSIARALLRQPDILVFDEAT 502 Query: 171 SMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIF 230 S LD I EE+ +T+R + + I I H L+ AD+I V+ G EG EE+ Sbjct: 503 SSLDSITEEEITKTIRSVSDLTDHITILIAHRLSTIKHADKIYVLEKGNIIEEGRHEELI 562 Query: 231 KLN 233 N Sbjct: 563 AQN 565 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 583 Length adjustment: 31 Effective length of query: 250 Effective length of database: 552 Effective search space: 138000 Effective search space used: 138000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory