Align Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 (characterized)
to candidate CA265_RS09295 CA265_RS09295 kynureninase
Query= SwissProt::Q9CXF0 (464 letters) >FitnessBrowser__Pedo557:CA265_RS09295 Length = 429 Score = 360 bits (923), Expect = e-104 Identities = 193/417 (46%), Positives = 259/417 (62%), Gaps = 18/417 (4%) Query: 34 DEEDKLSHFRNCFYIPKMRDLPSIDLSLVSEDDDAIYFLGNSLGLQPKMVRTYLEEELDK 93 DE D+L FR+ F P D IY GNSLGLQPK+ L+ +L+ Sbjct: 14 DETDQLRDFRSQFLFPN------------HNGKDLIYLCGNSLGLQPKVAGEVLKNQLNN 61 Query: 94 WAKMGAYGHDVGKRPWIVGDESIVSLMKDIVGAHEKEIALMNALTINLHLLLLSFFKPTP 153 WA G G PWI +++ LM IVGA E+ MN LT+NLHLL++SF++P Sbjct: 62 WANYAVEGWFDGNEPWIFYHKALKKLMAPIVGALPSEVCPMNTLTVNLHLLMVSFYQPKG 121 Query: 154 KRHKILLEAKAFPSDHYAIESQIQLHGLDVEKSMRMVKPREGEETLRMEDILEVIEEEGD 213 KR KI++E AFPSD YAIESQ++ HG D ++++ V P+EGEE L DI+ I+E D Sbjct: 122 KRFKIIMEGGAFPSDQYAIESQVRFHGFDPKEAIIEVFPKEGEEILHTADIIAQIKENAD 181 Query: 214 SIAVILFSGLHFYTGQLFNIPAITKAGHAKGCFVGFDLAHAVGNVELRLHDWGVDFACWC 273 IA++LF G+++YTGQ +++ ITKAGH G VG+DLAHA GNV ++LHDW VDFACWC Sbjct: 182 EIALVLFGGINYYTGQWYDMETITKAGHEIGAIVGWDLAHAAGNVPVKLHDWDVDFACWC 241 Query: 274 SYKYLNSGAGGLAGAFVHEKH-AHTVKPALVGWFGHDLSTRFNMDNKLQLIPGANGFRIS 332 SYKY NSG GG++G FVHEKH +T GW+G+ RF M+ GA+G+++S Sbjct: 242 SYKYQNSGPGGISGIFVHEKHFNNTGLNRFAGWWGYQEHKRFKMEKGFIPETGADGWQVS 301 Query: 333 NPPILLVCSLHASLEVFQQA-TMTALRRKSILLTGYLEYMLKHYHSKDNTENKGPIVNII 391 ++ + HASL++F+QA + LR KSI LT YLEY++ ++ N E II Sbjct: 302 CTQVMPMALYHASLQIFEQAGFIEPLRNKSITLTAYLEYII----NEINKELGVLQYKII 357 Query: 392 TPSRAEERGCQLTLTFSIPKKSVFKELEKRGVVCDKREPDGIRVAPVPLYNSFHDVY 448 TP A++RG QL++ K +F L V+ D REPD IR++ VPLYNSF DVY Sbjct: 358 TPKVAKDRGAQLSIIAERNGKQIFDGLMANHVLGDWREPDVIRLSAVPLYNSFEDVY 414 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 429 Length adjustment: 33 Effective length of query: 431 Effective length of database: 396 Effective search space: 170676 Effective search space used: 170676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate CA265_RS09295 CA265_RS09295 (kynureninase)
to HMM TIGR01814 (kynU: kynureninase (EC 3.7.1.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01814.hmm # target sequence database: /tmp/gapView.19433.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01814 [M=400] Accession: TIGR01814 Description: kynureninase: kynureninase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-132 426.5 0.0 5.7e-132 426.3 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS09295 CA265_RS09295 kynureninase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS09295 CA265_RS09295 kynureninase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.3 0.0 5.7e-132 5.7e-132 2 396 .. 11 421 .. 10 425 .. 0.95 Alignments for each domain: == domain 1 score: 426.3 bits; conditional E-value: 5.7e-132 TIGR01814 2 ealdaadelkalRdeFalpkakdeneviyld.NSLalmpkaakealkeeldkWakllveshevgkapW 68 ++ d+ d+l+++R++F +p+++++ + iyl+ NSL+l+pk+a e+lk++l++Wa+++ve+++ g+ pW lcl|FitnessBrowser__Pedo557:CA265_RS09295 11 QTQDETDQLRDFRSQFLFPNHNGK-DLIYLCgNSLGLQPKVAGEVLKNQLNNWANYAVEGWFDGNEPW 77 6789***************76665.5666644************************************ PP TIGR01814 69 leldealeklla..lvakekevvvmnsltvNlhkllasfykptekRakIlleakaFPsDlyaiesqlk 134 + +++al+kl+a ++a +ev mn+ltvNlh+l++sfy+p kR+kI++e aFPsD yaiesq++ lcl|FitnessBrowser__Pedo557:CA265_RS09295 78 IFYHKALKKLMApiVGALPSEVCPMNTLTVNLHLLMVSFYQPKGKRFKIIMEGGAFPSDQYAIESQVR 145 *************999**************************************************** PP TIGR01814 135 lk.leveeslvqvepre.eetlrledildviekeqdeiAlvllsgvqYkt.qlfdlaaitkaarkkga 199 + +++e +++v p+e ee l++ di + i+++ deiAlvl+ g++Y+t q +d+++itka+++ ga lcl|FitnessBrowser__Pedo557:CA265_RS09295 146 FHgFDPKEAIIEVFPKEgEEILHTADIIAQIKENADEIALVLFGGINYYTgQWYDMETITKAGHEIGA 213 ******************************************************************** PP TIGR01814 200 lvvfDLaHava.vpleLhdwdvDfAvwCsYKylnasp.a.agafvhekkakee.lprlalwwwheksk 263 +v++DLaHa++ vp++LhdwdvDfA+wCsYKy n++p +g+fvhek+++++ l r+a+ww+ ++ k lcl|FitnessBrowser__Pedo557:CA265_RS09295 214 IVGWDLAHAAGnVPVKLHDWDVDFACWCSYKYQNSGPgGiSGIFVHEKHFNNTgLNRFAGWWGYQEHK 281 *************************************856*********9765389************ PP TIGR01814 264 rfkmeeklelrp..aafrlsnppvlsvaalka.Lelfdqas.lealRkkSllLTdyleeLvkarlayk 327 rfkme+ + ++ ++++s +v+ +a +a L++f+qa +e lR+kS++LT yle++++ ++ lcl|FitnessBrowser__Pedo557:CA265_RS09295 282 RFKMEKGFIPETgaDGWQVSCTQVMPMALYHAsLQIFEQAGfIEPLRNKSITLTAYLEYIINEINKEL 349 *********999989****************99******985799****************8766655 PP TIGR01814 328 ..lvleiitPedtaer.sqlslkfskedkavlkalkkrdvviDkRePnviRlaPvpLYntfkDvykav 392 l +iitP+ ++r +qls+ + + k+++ l++++v+ D+ReP+viRl vpLYn+f+Dvy a lcl|FitnessBrowser__Pedo557:CA265_RS09295 350 gvLQYKIITPKVAKDRgAQLSIIAERNGKQIFDGLMANHVLGDWREPDVIRLSAVPLYNSFEDVYLAG 417 556678***********************************************************988 PP TIGR01814 393 evle 396 ++l lcl|FitnessBrowser__Pedo557:CA265_RS09295 418 QALL 421 8775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (400 nodes) Target sequences: 1 (429 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory