Align 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 (characterized)
to candidate CA265_RS24850 CA265_RS24850 aldehyde dehydrogenase
Query= SwissProt::Q9H2A2 (487 letters) >FitnessBrowser__Pedo557:CA265_RS24850 Length = 454 Score = 214 bits (544), Expect = 7e-60 Identities = 139/454 (30%), Positives = 224/454 (49%), Gaps = 11/454 (2%) Query: 29 DPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERSRVLNQVADLLEQSLEEFA 88 +P+T E+ + ++ A ++A P W+ ++ QER V+ +DLLE +E+ A Sbjct: 5 NPATAEIITSLEEDNLSTLQLKFDALQKAQPQWAGKTLQERIAVITHFSDLLEVEIEKLA 64 Query: 89 QAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYTVRAPVGVA 148 + + GK L +R +I + ++ +++ + ++ D G P+GV Sbjct: 65 SVLTSEVGKPLQQSRN-EINGARARIKWMLANAEKYLADEVMTDEPGIKEIIKYEPLGVV 123 Query: 149 GLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVF 208 IS WN P + PA+ +GNTV+ KPSE ++T + KLL KAGVP V +I Sbjct: 124 CNISAWNYPYLVGVNVFIPALLSGNTVMYKPSEYATLTGIEIEKLLKKAGVPDDVFHIAI 183 Query: 209 GTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDA-N 267 G G AL++ + FTGS T + I + A LELGGK+P I +D + Sbjct: 184 GA-KETGSALLNM-DFNGYFFTGSYKTGKLIYEKVAAKMVPCQLELGGKDPLYITDDVTD 241 Query: 268 LDECIPATVRSSFANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIG 327 + T +F N G+ C RI+VQ+ Y ++ FV + WK GIP+ V IG Sbjct: 242 VAAAAIGTADGAFYNNGQSCCAVERIYVQEKNYDDYCNAFVTEVKSWKTGIPTAEGVYIG 301 Query: 328 ALISKAHLEKVRSYVKRALAEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCC 387 AL K + + + VK AL +GA++ G A GY+ PTV+TD+ ++ Sbjct: 302 ALTRKEQISVLENQVKDALNKGAKLLTGG-------KAVEGKGYYFEPTVLTDVTNDMLV 354 Query: 388 MTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNC 447 M EE FGP+ ++ + E ++ + YGL A+V++++ R ++ +L +G + NC Sbjct: 355 MQEESFGPIIGIMKVKDDAEALKMMKDTDYGLTASVYTASQERAEKILAQLDAGSGYWNC 414 Query: 448 WLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIK 481 LP+ G K SGIG + FT+ K Sbjct: 415 CDRVSAALPWSGRKYSGIGATLSHQGIRAFTKPK 448 Lambda K H 0.319 0.133 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 454 Length adjustment: 33 Effective length of query: 454 Effective length of database: 421 Effective search space: 191134 Effective search space used: 191134 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory