Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate CA265_RS12370 CA265_RS12370 alpha/beta hydrolase
Query= BRENDA::G3KFX4 (282 letters) >FitnessBrowser__Pedo557:CA265_RS12370 Length = 291 Score = 81.3 bits (199), Expect = 2e-20 Identities = 47/131 (35%), Positives = 74/131 (56%), Gaps = 3/131 (2%) Query: 2 NAPQQSPEIGREILAAGYRTNLHDQGEGFPVLLIHGSGPGVTAWANWRLVMPQLAQNRRV 61 NA Q P + G + G+G PV+L+HG+ +T ANW ++PQL++ R+V Sbjct: 28 NAQQGKPNGSGFVPVNGIKVYYETYGQGKPVILLHGAF--MTIEANWGQLIPQLSKTRKV 85 Query: 62 IAPDMLGFGYSDRPADGRYHQQRWVEHAIGVLDALGIQQADIVGNSFGGGLALALAIRHP 121 IA ++ G G+S +D + GV+D L I AD++G SFGG +A AI+ P Sbjct: 86 IAIELQGHGHSPF-SDRKLSHVTLASDVAGVMDYLKIDSADVIGYSFGGSVAYQFAIQSP 144 Query: 122 ERVRRLVLMGS 132 +R+ +LV++ S Sbjct: 145 KRLGKLVIISS 155 Lambda K H 0.323 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 291 Length adjustment: 26 Effective length of query: 256 Effective length of database: 265 Effective search space: 67840 Effective search space used: 67840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory