GapMind for catabolism of small carbon sources

 

Aligments for a candidate for CAT in Pedobacter sp. GW460-11-11-14-LB5

Align Plastidic cationic amino acid transporter, CAT, of 582 aas and 14 TMSs (characterized)
to candidate CA265_RS15145 CA265_RS15145 amino acid permease

Query= TCDB::ALD51314.1
         (582 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS15145 CA265_RS15145 amino acid
           permease
          Length = 649

 Score =  207 bits (527), Expect = 1e-57
 Identities = 139/452 (30%), Positives = 224/452 (49%), Gaps = 61/452 (13%)

Query: 28  RAGSVSTCFEETSRVRARSGGDMKRSLRWYDLVGFGVGGMVGAGVFVTSGRASSHCAGPA 87
           R  S+S   ++ ++        + ++L   DL  FG+  ++GAG+F T G+AS+   GPA
Sbjct: 7   RKKSISKILQDAAKGYGDHENTLHKTLGVRDLTAFGIAAIIGAGIFSTIGKASAD-GGPA 65

Query: 88  VVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYIRITFGEFLAFLTGANLIIDYVLSN 147
           V+  +         +AF Y EFA  +PV+G A++Y  + FGE +A++ G +LI++Y + N
Sbjct: 66  VIFLFIFTAVACSFAAFAYAEFASMVPVSGSAYTYSYVAFGELVAWIIGWSLIMEYSIGN 125

Query: 148 AAVARS----FTGYLCTA----LGIES----------------------KLRITVNGLPD 177
             VA S    FTG L T     LGIE                        L      L D
Sbjct: 126 ITVAISWSDYFTGLLSTIKIPPLGIEGIHVPDWMTMDYLSAYNGHKHAEALLAAGKNLAD 185

Query: 178 -------------------GFNEI-DVVAVLVVLALTVIICYSTRESSVLNMVLTVLHIV 217
                               F+ + D+ A+ +++ +T +I    +ES   +  + V+ + 
Sbjct: 186 LDSATALANNAWLTAPKIGSFHLVADIPALGIIILITWLIYRGMKESRNASNAMVVVKLA 245

Query: 218 FIVFVIVIGFTRGDTKNFTKAGDSNHASGFFPFGASGVFNGAAMVYLSYIGYDAVSTMAE 277
            I+ V+ +G    DTKN+           F P G SGV  G + V+ +YIG+DA+ST AE
Sbjct: 246 VILLVLAVGIFYVDTKNWDP---------FAPNGVSGVLKGVSAVFFAYIGFDAISTTAE 296

Query: 278 EVKNPVKDIPVGVSGSVILVTVLYCLMAASMSMLLPYDMIDPDAPFSGAFMGSDGWRWVS 337
           E KNP +D+P G+  ++I+ T+LY  +A  ++ ++  D +    P +  F      + +S
Sbjct: 297 ECKNPQRDLPRGMMWAIIICTILYVAIALVLTGIVKSDTLAVGDPLAFVF-DQINLKLMS 355

Query: 338 NVIGVGAGFGILTSLLVAMLGQARYMCVIGRSSVVPAWFAKVHPKTSTPVNASAFLGICT 397
            +I V A F + + LLV  +GQ R    + R  ++P  F+K+HPK  TP  A+  +G   
Sbjct: 356 GIIAVSAVFAMASVLLVFQMGQPRIWMSMSRDGLLPKSFSKIHPKYKTPSFATIVVGFVV 415

Query: 398 AAIALFTDLQILLNLVSIGTLFVFYMVANAVI 429
           A  +LF +L I+ +L SIGTLF F +V   V+
Sbjct: 416 AVPSLFMNLTIVTDLCSIGTLFAFVLVCAGVL 447


Lambda     K      H
   0.326    0.139    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 817
Number of extensions: 46
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 582
Length of database: 649
Length adjustment: 37
Effective length of query: 545
Effective length of database: 612
Effective search space:   333540
Effective search space used:   333540
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory