Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate CA265_RS20005 CA265_RS20005 enoyl-CoA hydratase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2986 (356 letters) >FitnessBrowser__Pedo557:CA265_RS20005 Length = 259 Score = 100 bits (250), Expect = 3e-26 Identities = 69/208 (33%), Positives = 114/208 (54%), Gaps = 15/208 (7%) Query: 3 AMQNEVLAEVRNHIGHLTLNRPAGLNALTLDMVRNLHRQLDAWAQDSQVHAVVLRGAGEK 62 A QN +++E++ +I ++T+NR LNAL D + L + + +V V+L GAGEK Sbjct: 2 AYQN-LISEIKENILYVTINREKALNALNKDTLAELADVIAFAGRTDEVRGVILTGAGEK 60 Query: 63 AFCAGGDIRSLHD-SFKSGDTL----HEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGG 117 AF AG DI+ D S K G+ L HE F AI + KP +A ++GF LGGG Sbjct: 61 AFVAGADIKEFSDYSGKQGEELAKRGHELVFN-------AIENSSKPFIAAINGFALGGG 113 Query: 118 MGLVQGADLRVVTEKSRLAMPEVGIGYFPDVGGSYFLSRIPGE-LGIYLGVSGVQIRAAD 176 + L +R+ ++ ++L +PEV +G P GG+ L+++ G+ I + + I A D Sbjct: 114 LELAMACHIRIASDNAKLGLPEVTLGLIPGYGGTQRLTQLVGKGKAIEMITTANMITATD 173 Query: 177 ALYCGLADWYL-ESGKLGVLDEKLDQLE 203 A GL + + ++ +G +E L+ ++ Sbjct: 174 AEKIGLVNVVVPQADLIGKAEEMLNVIK 201 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 259 Length adjustment: 27 Effective length of query: 329 Effective length of database: 232 Effective search space: 76328 Effective search space used: 76328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory