Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate CA265_RS18405 CA265_RS18405 dehydrogenase
Query= metacyc::MONOMER-11683 (330 letters) >FitnessBrowser__Pedo557:CA265_RS18405 Length = 658 Score = 187 bits (474), Expect = 8e-52 Identities = 110/309 (35%), Positives = 178/309 (57%), Gaps = 18/309 (5%) Query: 13 DQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAFALDREMDYVLPY 72 D+ +++YR +L R ++++M L R G+I S GQEA VG+ A+ + +Y+LP Sbjct: 10 DKFLLNLYRRLLYPRMVEDKMLKLLRQGRIGKWFSGIGQEAIAVGSTLAMQSD-EYILPM 68 Query: 73 YRDMGVVLAFGMTAKDLM------MSGFAKAADPNSGGRQMPGHFGQKKNRIVTGSSPVT 126 +R++GV + + K LM ++GF+K GR HFG ++ +I+ S + Sbjct: 69 HRNLGVFTSRDIPLKKLMAQWQGKITGFSK-------GRDRSFHFGTQEYKIIGMISHLG 121 Query: 127 TQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYA 186 Q+ A GIALA + + A V GEG++++GDFHE N AAV LPVIF+ ENN Y Sbjct: 122 PQMALADGIALADVLRNQPHATLVYTGEGATSEGDFHEAVNVAAVWNLPVIFLIENNGYG 181 Query: 187 ISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETIS 246 +S P +Q C+N+ D+AIGYG+ G+ ++GN+ LEVY + + R+ P L+E ++ Sbjct: 182 LSTPKSEQFRCKNLVDKAIGYGVEGIQIDGNNILEVYDTINQLAMEIRKDPRPVLVECLT 241 Query: 247 YRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVN 306 +R+ H + + Y +E +E +K DPL Y+AYL E G+L+ + T++D + + Sbjct: 242 FRMRGH-EEASGTKYVPQELFDEWEKKDPLNNYEAYLIEQGVLTPD---TVIDIKIQVKR 297 Query: 307 EATDEAENA 315 + E E A Sbjct: 298 DIELEIEEA 306 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 658 Length adjustment: 33 Effective length of query: 297 Effective length of database: 625 Effective search space: 185625 Effective search space used: 185625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory