Align 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) (EC 1.2.4.4) (characterized)
to candidate CA265_RS15185 CA265_RS15185 transketolase
Query= reanno::Smeli:SMc03202 (337 letters) >FitnessBrowser__Pedo557:CA265_RS15185 Length = 318 Score = 72.4 bits (176), Expect = 1e-17 Identities = 72/238 (30%), Positives = 103/238 (43%), Gaps = 32/238 (13%) Query: 58 ISESGIVGTAIGMAAYGLKPCVEIQFADYMYP-AYDQLTQEAARIRYRSNGDFTCPIVVR 116 I+E+ ++G A GM G P FA++ YDQ+ Q A Y + C Sbjct: 59 IAEANMIGIAAGMTIGGKIPFTGT-FANFSTGRVYDQIRQSVA---YSNKNVKICASHAG 114 Query: 117 MPTGGGIFGGQTHSQSPE-ALFTHVCGLKVVVPSNPYDAKGLLISAIEDPDPVMFLEPKR 175 + G G TH + L + G+ V+ P + K ++ E Sbjct: 115 LTLGED---GATHQILEDIGLMKMLPGMVVINPCDYNQTKAATMAIAE------------ 159 Query: 176 LYNGPFDGHHERPVTAWSKHELGDVPDGHYTIPIGKAEIRRKGSGVTVIAYGTMVHVALA 235 Y GP RPV + D IGKA + +G+ VT+IA G MV A+ Sbjct: 160 -YEGPVYLRFGRPV-------IPVFTDPDQKFEIGKAWMVNEGTDVTIIATGHMVWKAIE 211 Query: 236 AAE---ETGIDAEVIDLRSLLPLDLETIVQSAKKTGRCVVVHEATLTSGFGAELAALV 290 A E E GIDAE+I++ ++ PLD E I++S KKTG V E G G +A L+ Sbjct: 212 AGEKLAELGIDAEIINIHTIKPLDDEAILKSVKKTGCVVTCEEHNKFGGLGESVARLL 269 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 318 Length adjustment: 28 Effective length of query: 309 Effective length of database: 290 Effective search space: 89610 Effective search space used: 89610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory