Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate CA265_RS17525 CA265_RS17525 dihydrolipoamide succinyltransferase
Query= curated2:P37942 (424 letters) >FitnessBrowser__Pedo557:CA265_RS17525 Length = 413 Score = 257 bits (657), Expect = 4e-73 Identities = 157/419 (37%), Positives = 235/419 (56%), Gaps = 26/419 (6%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ +P +GES+TE +S+W+ GD V + IAE+ +DK E+ + GT+ + + E Sbjct: 4 EIKVPPVGESITEVVLSRWIKNDGDVVEMDEVIAELESDKATFELTAEQAGTL-KTIAAE 62 Query: 65 GQTLQVGEMICKIETEGANPAEQKQEQPAASEA------AENPVAKSAGAA--DQPNKKR 116 G TL +G ++CKIE GA + + + + S+A AE P + +G A D Sbjct: 63 GDTLAIGAVVCKIEDGGAAASPKPEAESPKSDAQAPAAVAEAPKTQDSGLATKDSYATGT 122 Query: 117 YSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSA 176 SPA ++ E GI+ V GTG GRIT+ D + E G + PE K +AP +A Sbjct: 123 PSPAAGKILAEKGIEASAVKGTGVDGRITKDDAVKA-EAG----KKPEAPKASAPVVAAA 177 Query: 177 SKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRN 236 PA + G++ ++ +R+ +A + K E T EV++ ++ R Sbjct: 178 -----------PAGSRGERREKMSPLRRTVAKRLVAVKNETAMLTTFNEVNMKPIMDLRG 226 Query: 237 SIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDS 296 KD FK+ G L F +FF KAV +ALK+FP +N G++++ +ISIAV+ Sbjct: 227 KYKDQFKEKFGVGLGFMSFFTKAVTEALKDFPAVNGRIEGEELVYNDFADISIAVSAPKG 286 Query: 297 LFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGII 356 L VPVI+NA+ T+ I K + LA K RD KLT ++M GGTFT+ N G FGS+ S II Sbjct: 287 LVVPVIRNAESMTLAQIEKSVLELALKARDSKLTIEEMTGGTFTITNGGVFGSMMSTPII 346 Query: 357 NYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 N PQ+AIL + +IV+RPV + G + +R M+ + LS DHR++DG FL RVKQ+LE Sbjct: 347 NAPQSAILGMHNIVERPVA-EKGEVVIRPMMYVALSYDHRIIDGRESVGFLVRVKQLLE 404 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 413 Length adjustment: 32 Effective length of query: 392 Effective length of database: 381 Effective search space: 149352 Effective search space used: 149352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory