Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate CA265_RS20005 CA265_RS20005 enoyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__Pedo557:CA265_RS20005 Length = 259 Score = 218 bits (554), Expect = 1e-61 Identities = 118/261 (45%), Positives = 177/261 (67%), Gaps = 4/261 (1%) Query: 1 MEFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG-K 59 M ++ + ++ + N+ ++T+NR LNALN L EL ++ A E+R +I+TG G K Sbjct: 1 MAYQNLISEIKENILYVTINREKALNALNKDTLAELADVIAFAGRTDEVRGVILTGAGEK 60 Query: 60 AFCAGADITQFNQLTPAEAWKFSKKGREIM-DKIEALSKPTIAMINGYALGGGLELALAC 118 AF AGADI +F+ + + + +K+G E++ + IE SKP IA ING+ALGGGLELA+AC Sbjct: 61 AFVAGADIKEFSDYSGKQGEELAKRGHELVFNAIENSSKPFIAAINGFALGGGLELAMAC 120 Query: 119 DIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLV 178 IRIA++ A+LGLPE+ LG+ PGYGGTQRLT+++GKG+A+EM+ T + I DAEK GLV Sbjct: 121 HIRIASDNAKLGLPEVTLGLIPGYGGTQRLTQLVGKGKAIEMITTANMITATDAEKIGLV 180 Query: 179 NRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 N VVP A+L + ++ I +++P++++ + V +++ +G A E +G F T Sbjct: 181 NVVVPQADLIGKAEEMLNVIKQRAPLAISAAIKSVIASINN--TNGYATEIEEFGKCFET 238 Query: 239 EDKKEGVSAFLEKREPTFKGK 259 D KEGV+AF+EKR+ F GK Sbjct: 239 ADFKEGVTAFVEKRKAIFTGK 259 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 259 Length adjustment: 24 Effective length of query: 235 Effective length of database: 235 Effective search space: 55225 Effective search space used: 55225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory