Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Pedo557:CA265_RS07485 Length = 252 Score = 129 bits (323), Expect = 1e-34 Identities = 80/221 (36%), Positives = 121/221 (54%), Gaps = 15/221 (6%) Query: 4 IHCQALAKHYAGGPPVLHPL---DLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 I + + + Y G V+H L L I GEFV L+GPSG GKST++ ++ L+ S GT Sbjct: 6 ITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSGT 65 Query: 61 LRIGGTVVNDLP------ARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRR 114 + GT V+ + R + + VFQ + L P + DN+A L + ++ DR Sbjct: 66 YVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPL--IYAGTSKKDRD 123 Query: 115 VREVAALLN--LEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQ 172 R AL N L ++ KP +SGGQ+QR A+ARA+I PS+ L DEP NLD K + Sbjct: 124 ARAARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIE 183 Query: 173 LRGDIKRLHQRLRTTTVYVTHDQLEAMTLADRVILMQDGRI 213 + G ++ +H + T + VTH++ + A R++ M+DG I Sbjct: 184 IMGLLEEIHSK-GNTIILVTHEE-DIAQHAHRIVRMRDGLI 222 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 252 Length adjustment: 28 Effective length of query: 378 Effective length of database: 224 Effective search space: 84672 Effective search space used: 84672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory