GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Echvi_1871 in Pedobacter sp. GW460-11-11-14-LB5

Align SSS sodium solute transporter (characterized, see rationale)
to candidate CA265_RS04220 CA265_RS04220 sodium:solute symporter

Query= uniprot:L0FZF3
         (547 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS04220 CA265_RS04220
           sodium:solute symporter
          Length = 550

 Score =  268 bits (686), Expect = 3e-76
 Identities = 175/564 (31%), Positives = 292/564 (51%), Gaps = 38/564 (6%)

Query: 4   NTLDLVVFVAYCLLIITMGIVV-SREKKGHVKDSKDYFLASKALPWWAVGASLIASNISA 62
           +T D+V+ +AY L I+T+G+   +R+KK     S +YFLA K L W  +G +L A+NIS 
Sbjct: 3   STTDIVITIAYILFIVTIGLWTGTRKKKNEETTSGEYFLAGKTLKWPMIGLALFATNISC 62

Query: 63  EQFIGMSGSGFALGLAISTYEWMAAATLLVVAIFFLPIYLKEGIYTMPQFLNRRYDGRVR 122
              + ++ SGF  GL    +EWMAA TL+++A+ F+P Y++ GI T+P FL RRY+   R
Sbjct: 63  LHLVSLAQSGFDSGLLNGNFEWMAAFTLILLALLFIPFYIRSGISTLPDFLERRYNRACR 122

Query: 123 TVMAIFWLLIYVFVNLTSVLYLGALSLETIMGVPLTYGIIGLALFAMVYSIYGGLKAVAW 182
             +A   +L  + +++      G + LET+ G+ +   I+ +AL   +Y+I GGL+AV  
Sbjct: 123 DWLAFISILSAIIIHIAFSFLAGGIVLETLFGIDMYVSIVVIALLTGLYTIIGGLRAVVV 182

Query: 183 TDVVQVVFLVAGGLATTYLALSLVGDGDVWEGIGILRKAAPSHFSMIIEKGEMMIPDGSG 242
           T+ +Q + L+ G +  TY A + VG  D    I + ++ A    SMI       I D SG
Sbjct: 183 TETIQSLVLITGAIIITYFAWNKVGGWDHMTAI-LQKENAMDKLSMI-----RPIGDKSG 236

Query: 243 GSRDA-YLDLPGLSVLIGGMWIVNLNYWGCNQYITQRALAAKSLGEAQTGMVFAGFLKLL 301
            S  A +L  P L     G+W     YW  +Q I QR L AK    A+ G +F GF+K+L
Sbjct: 237 MSWIAVFLGYPVL-----GIW-----YWCADQTIVQRVLGAKDENHARVGSLFCGFIKIL 286

Query: 302 MPLIVVIPGIAAYVIVQKGA-DASFIESMTDPVTGLAKSDRAYPTLL-HLLPPGLKGLAF 359
              I V+PG+ AY++ + G  D S ++++      +  +   Y  ++  LLP GL G+  
Sbjct: 287 PVFIFVLPGLFAYILYKSGTMDLSSLQTVGSNGETVLNTKGIYTLMITQLLPKGLVGILV 346

Query: 360 AALTAAIVSSLASMANSTSTIFTIDIYKEFFNKNVSEGKQVTIGRITAVVAFIIAAIVAP 419
           AAL + ++S +A   NS +T+ + D+YK  F    S+ K V++GR +A +A  ++  + P
Sbjct: 347 AALLSGLMSQIAGALNSIATLSSYDLYKR-FKPETSDKKLVSVGRWSAGIALTVSIGLLP 405

Query: 420 QLRQLDQAFQYIQEYTGFVSPGVFAIFIFGFFWKKTTSNAA---------LTAAVLTIPL 470
            L   +  F  I +    ++P +  +F+ G FWKK ++  A         + A V  +  
Sbjct: 406 LLNSYESLFNGINDVIAHIAPPITCVFLLGVFWKKASAKGAQYTLLLGSIIGAGVFVVNK 465

Query: 471 SAAFKVITPNLPFIDRMGVVFLVLSVLIIAIS-LYEGKGKDSKKAI-------EVDAELF 522
               + I   +PF+     +F +  ++ +  S +Y  K     + +        + ++ +
Sbjct: 466 VYGTETIIGQIPFMMMAFYLFCICVLIQVVFSHIYPVKHTAQSETLYWTSIWEPLKSKGW 525

Query: 523 STSTKFKVGAVLICGILVALYSVF 546
           S    +K  +VL+  I+  LY  F
Sbjct: 526 SGIGNYKFLSVLLLAIMGVLYVYF 549


Lambda     K      H
   0.326    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 691
Number of extensions: 36
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 547
Length of database: 550
Length adjustment: 36
Effective length of query: 511
Effective length of database: 514
Effective search space:   262654
Effective search space used:   262654
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory