GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Echvi_1871 in Pedobacter sp. GW460-11-11-14-LB5

Align SSS sodium solute transporter (characterized, see rationale)
to candidate CA265_RS06755 CA265_RS06755 sodium transporter

Query= uniprot:L0FZF3
         (547 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS06755 CA265_RS06755 sodium
           transporter
          Length = 542

 Score =  598 bits (1543), Expect = e-175
 Identities = 308/556 (55%), Positives = 400/556 (71%), Gaps = 30/556 (5%)

Query: 4   NTLDLVVFVAYCLLIITMGIVVSREKKGHVKDSKDYFLASKALPWWAVGASLIASNISAE 63
           +  D  VF+ Y +++   G  V R KK    D+KDYFLA  +L WWA+GAS+IASNISAE
Sbjct: 5   SAFDYAVFLMYFVIVSAYGYWVYRSKKKKRTDTKDYFLAEGSLTWWAIGASIIASNISAE 64

Query: 64  QFIGMSGSGFALGLAISTYEWMAAATLLVVAIFFLPIYLKEGIYTMPQFLNRRYDGRVRT 123
            FIGMSGSGFA+GLAI++YEWMAAATL++VAIFFLPIY+K  IYTMPQFL+ RY+  V T
Sbjct: 65  HFIGMSGSGFAMGLAIASYEWMAAATLIIVAIFFLPIYIKNKIYTMPQFLSNRYNNTVST 124

Query: 124 VMAIFWLLIYVFVNLTSVLYLGALSLETIMGVPLTYGIIGLALFAMVYSIYGGLKAVAWT 183
           +MA+FWLL+YVFVNLTS+ +LGA+++ETI GVP    II LA+F+ + ++ GG+K + +T
Sbjct: 125 LMAVFWLLVYVFVNLTSIFFLGAIAIETITGVPFNICIIFLAIFSAIITL-GGMKVIGYT 183

Query: 184 DVVQVVFLVAGGLATTYLALSLVGD----GDVWEGIGILRKAAPSHFSMIIEKGEMMIPD 239
           DV+QV  LVAGGL T Y+AL LV +      V   + +LR  A  HF MI  KG+     
Sbjct: 184 DVIQVFVLVAGGLITCYMALKLVSEKLDAPSVLASLPLLRSEASDHFHMIFSKGDKF--- 240

Query: 240 GSGGSRDAYLDLPGLSVLIGGMWIVNLNYWGCNQYITQRALAAKSLGEAQTGMVFAGFLK 299
                   Y +LPG++VL+GG+WI NLNYWGCNQYI QRAL A  L   + G++FA FLK
Sbjct: 241 --------YNELPGIAVLVGGLWINNLNYWGCNQYIVQRALGA-DLKTGRNGLIFAAFLK 291

Query: 300 LLMPLIVVIPGIAAYVIVQKGADASFIESMTDPVTGLAKSDRAYPTLLHLLPPGLKGLAF 359
           LL+P+IVVIPGIAAYV+ Q+G    F   M D   G+ K D AYP L++LLP G+KGLAF
Sbjct: 292 LLIPVIVVIPGIAAYVLYQRG---YFHSEMLD-AAGVVKPDHAYPVLMNLLPAGIKGLAF 347

Query: 360 AALTAAIVSSLASMANSTSTIFTIDIYKEFFNKNVSEGKQVTIGRITAVVAFIIAAIVAP 419
           AALTAAIV+SLA   NS +TIFT+DIYK+F     SE + V++GR + V+A +IA I+AP
Sbjct: 348 AALTAAIVASLAGKCNSIATIFTLDIYKKFIKPEASETRLVSVGRWSVVIASLIAIIIAP 407

Query: 420 QLRQLDQAFQYIQEYTGFVSPGVFAIFIFGFFWKKTTSNAALTAAVLTIPLSAAFK---- 475
            LR  DQ +Q+IQEY GF+SPGVFAIF+ GFFWKKTTS AALTAA+LTIPLS  FK    
Sbjct: 408 ALRSFDQVYQFIQEYVGFISPGVFAIFLLGFFWKKTTSRAALTAALLTIPLSTLFKFLPA 467

Query: 476 ----VITPNLPFIDRMGVVFLVLSVLIIAISLYEGKGKDSKKAIEVDAELFSTSTKFKVG 531
                I P +PF++RM  VF+++  L+I ++L + K KD+ + +E+D+ +F  +  F + 
Sbjct: 468 VTNGAIAP-IPFLNRMSWVFMIIIGLMIVVTLTDPKSKDNPQGLEIDSSMFKVTPAFTIA 526

Query: 532 AVLICGILVALYSVFW 547
           +V+ICGIL ALY+VFW
Sbjct: 527 SVMICGILAALYTVFW 542


Lambda     K      H
   0.326    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 815
Number of extensions: 39
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 547
Length of database: 542
Length adjustment: 35
Effective length of query: 512
Effective length of database: 507
Effective search space:   259584
Effective search space used:   259584
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory