Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate CA265_RS04175 CA265_RS04175 phosphonate ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__Pedo557:CA265_RS04175 Length = 232 Score = 135 bits (339), Expect = 1e-36 Identities = 72/203 (35%), Positives = 119/203 (58%), Gaps = 2/203 (0%) Query: 4 IRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSG- 62 I++ENL K++K + E A++ +++ + +G ++GPSG GK+T L ++ L++P +G Sbjct: 2 IKIENLEKVYKTEEVETTALNGINLHVAAGEFVSIMGPSGCGKSTLLNVMGLLDKPENGS 61 Query: 63 YIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENK 122 Y + D E ++ R + KR + VFQN+ L +TVF+NI PL K+P + + Sbjct: 62 YKFIDTELLTLNDRERSNFRKRNMGFVFQNFNLIDELTVFENIELPLIYNKIPAGERKKL 121 Query: 123 VKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESAR 182 V E+ E + + +P++LSGGQ QR A+ARALV PK++L DEP NLD+ Sbjct: 122 VNEIIERMNIVNRSGHFPQQLSGGQQQRVAVARALVTKPKLVLADEPTGNLDSSHGNEVM 181 Query: 183 ALVRKIQRERKLTTLIVSHDPAD 205 L+ ++ E T ++V+H D Sbjct: 182 ELLCEL-NETGTTIVMVTHSSHD 203 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 232 Length adjustment: 26 Effective length of query: 345 Effective length of database: 206 Effective search space: 71070 Effective search space used: 71070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory