Align D-xylose 1-dehydrogenase (NADP(+)) 1; XDH 1; EC 1.1.1.179 (characterized)
to candidate CA265_RS12040 CA265_RS12040 hypothetical protein
Query= SwissProt::D4GP29 (390 letters) >FitnessBrowser__Pedo557:CA265_RS12040 Length = 386 Score = 167 bits (422), Expect = 6e-46 Identities = 103/340 (30%), Positives = 173/340 (50%), Gaps = 14/340 (4%) Query: 29 AMIGLGWWTRDEAIPAVEASEFCETTVVVSSSKEKAEGATALTESITHG--LTYDEFHEG 86 A++GLG +E IPA+ +F +VS +K E AL ++ G +Y+ F E Sbjct: 51 AVVGLGHLALEEVIPALSGCKFSRLAALVSGDDKKME-KVALQYGVSPGSCYSYERFDEI 109 Query: 87 VAADAYDAVYVVTPNGLHLPYVETAAELGKAVLCEKPLEASVERAEKLVAACDRADVPLM 146 +Y++ PN +H+ + A GK +LCEKP+ S K++AAC++A V LM Sbjct: 110 KNNTDVSVIYIILPNSMHMEFTVRGARAGKHILCEKPMANSSAECRKMIAACNKAKVKLM 169 Query: 147 VAYRMQTEPAVRRARELVEAGVIGEPVFVHGHMSQRLLDEVVPDPDQWRLDPELSGGATV 206 +AYRMQ +P + +E+V G ++ + + + +PD WR +L+GG + Sbjct: 170 IAYRMQFQPHTLKLKEMVSNERFGRVRYI-----ETVNGQSSANPDHWRHKAKLAGGGVL 224 Query: 207 MDIGLYPLNTARFVLDADPVRVRA--TARVDDEAFEAVGDEHVSFGVDFDDGTLAVCTAS 264 DIG+Y LNT RF+L +P+ V A + D F+ +E +S+ + FD+G +A C A Sbjct: 225 PDIGIYCLNTTRFILGKEPIEVFAYQYSTPKDPLFKDT-EELISWQMKFDEGLIASCMAH 283 Query: 265 QSAYQLSHLRVTGTEGELEIEPAF-YNRQKRGFRLSWGDQSAD--YDFEQVNQMTEEFDY 321 ++ +R+ G + ++ AF Y Q+ + G++ + + NQ E D+ Sbjct: 284 YKIREVKTMRIHAERGWMFMDRAFAYKGQQLKTSRAEGEEEIEETISVPEPNQFGAEMDH 343 Query: 322 FASRLLSDSDPAPDGDHALVDMRAMDAIYAAAERGTDVAV 361 F+ +L DP + L D M+AIY +A+ G V + Sbjct: 344 FSECILRKKDPKTPAEEGLRDHVIMEAIYKSAKTGKPVKI 383 Lambda K H 0.315 0.131 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 386 Length adjustment: 30 Effective length of query: 360 Effective length of database: 356 Effective search space: 128160 Effective search space used: 128160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory