GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylB in Pedobacter sp. GW460-11-11-14-LB5

Align Xylulose kinase (Xylulokinase) (characterized, see rationale)
to candidate CA265_RS19710 CA265_RS19710 carbohydrate kinase

Query= uniprot:Q8A9M3
         (497 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS19710 CA265_RS19710
           carbohydrate kinase
          Length = 494

 Score =  560 bits (1443), Expect = e-164
 Identities = 274/487 (56%), Positives = 344/487 (70%), Gaps = 3/487 (0%)

Query: 1   MFLLGYDIGSSSVKASLVNAETGKCVSSAFFPKTEAKIIAVNPGWAEQDPESWWENLKLS 60
           M+LLG D+G+SS+K ++V+A T + V+SA +P+ E  I ++  GWAEQ P  WW+N++ +
Sbjct: 1   MYLLGIDLGTSSIKVAVVDATTQRNVASAQYPEEETAIKSLQSGWAEQSPNDWWQNVQQA 60

Query: 61  TQAIMAESGVSAAEIKAIGISYQMHGLVCVDKNQQVLRPAIIWCDSRAVPFGQQAFETIG 120
              + +       EIKAIGI+YQMHGLV VDKNQ+VLR +IIWCDSRAV  G  AFE IG
Sbjct: 61  ILKLNSTGLFDPKEIKAIGIAYQMHGLVVVDKNQEVLRDSIIWCDSRAVELGNGAFEAIG 120

Query: 121 EERCLSHLLNSPGNFTASKLAWIKQNEPAVYEQIYKIMLPGDYIAMKLSGDICTTVSGLS 180
            E+ L HLLNSPGNFTASKLAW+K NEP +Y +I KIMLPGD+IAMKL+G+I T++S LS
Sbjct: 121 NEKSLKHLLNSPGNFTASKLAWVKANEPDIYSRIDKIMLPGDFIAMKLTGEITTSISALS 180

Query: 181 EGMFWDFKNNRVADFLMDYYGFDSSLIADIKPTFAEQGRVNAVAANELGLKEGTPITYRA 240
           EG+FWDF+N+ ++  +M+YY     LI  IKP F+E G +    A  LGL  G P+ Y++
Sbjct: 181 EGIFWDFENHEISKDVMNYYSISVDLIPTIKPLFSEHGYLKTAIAQALGLTTGIPVAYKS 240

Query: 241 GDQPNNALSLNVFNPGEIASTAGTSGVVYGVNGEVNYDPQSRVNTFAHVNHTMEQTRLGV 300
           GDQPNNALSLNV  PGE+A+TAGTSGV+YG++  + YD QSRVNTFAHV  T EQ   GV
Sbjct: 241 GDQPNNALSLNVLKPGEVAATAGTSGVIYGISDGLTYDKQSRVNTFAHVTFTEEQKHTGV 300

Query: 301 LLCINGTGILNSWVKRNIAPEGISYNEMNVLASKAPIGSAGISILPFGNGAERMLNNKEI 360
           LLCINGTG +  W K N AP+  +Y E+N LASKAPIGS G+ +LPFGNGAERMLNNK  
Sbjct: 301 LLCINGTGSMYRWAKHNFAPQS-TYAELNNLASKAPIGSNGLKVLPFGNGAERMLNNKYT 359

Query: 361 GCSIRGVDFNAHGKHHIIRAAQEGIVFSFKYGIDIMEQMGIPVKKIHAGHANMFLSSIFR 420
           G  + G+D N H    I RA QEGI FSF+YG+DIM + G+  K I AG AN+FLS +F 
Sbjct: 360 GAQLLGIDLNRHNPSDIFRAVQEGIAFSFRYGLDIMRENGMKPKVIRAGRANLFLSDVFA 419

Query: 421 DTLAGVTGATIELYDTDGSVGAAKGAGIGAGIYKDNNEAFATLDKLDVIEPNIAKRQEYA 480
            T   VTG  +ELY+ DGSVGA  GAGIGAGI+K   EAF+  + +  + P       Y 
Sbjct: 420 QTFVDVTGIPVELYENDGSVGAGIGAGIGAGIFKSAEEAFSNHEVIKTLMPQ--HPAAYE 477

Query: 481 DAYARWK 487
             Y  WK
Sbjct: 478 PIYQDWK 484


Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 689
Number of extensions: 26
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 494
Length adjustment: 34
Effective length of query: 463
Effective length of database: 460
Effective search space:   212980
Effective search space used:   212980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory