Protein GFF2770 in Phaeobacter inhibens BS107
Annotation: FitnessBrowser__Phaeo:GFF2770
Length: 505 amino acids
Source: Phaeo in FitnessBrowser
Candidate for 8 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| 2'-deoxyinosine catabolism | nupA | lo | RnsB, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized) | 36% | 98% | 327.8 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| L-fucose catabolism | HSERO_RS05250 | lo | Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) | 35% | 94% | 295 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| D-ribose catabolism | rbsA | lo | ribose transport, ATP-binding protein RbsA; EC 3.6.3.17 (characterized) | 37% | 95% | 287 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| myo-inositol catabolism | iatA | lo | Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) | 35% | 97% | 276.6 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| D-galactose catabolism | BPHYT_RS16930 | lo | Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale) | 35% | 92% | 266.5 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| D-xylose catabolism | xylG | lo | Xylose import ATP-binding protein XylG, component of Xylose transporter, XylFGH (XylF (R), 359 aas; XylG (C), 525 aas; XylH (M), 389 aas (characterized) | 32% | 98% | 262.7 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| L-arabinose catabolism | araG | lo | L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized) | 33% | 95% | 258.1 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
| 2'-deoxyinosine catabolism | H281DRAFT_01113 | lo | deoxynucleoside transporter, ATPase component (characterized) | 33% | 94% | 248.1 | Glucose import ATP-binding protein TsgD13; EC 7.5.2.- | 39% | 354.4 |
Sequence Analysis Tools
View GFF2770 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTQPLLSLQGLTKAYPGVVANDTVSFDIGAGEVHALLGENGAGKSTLVKMIYGLVKPDSG
KMLLHGEPYTPGEPRQARADGIAMVFQHFSLFDALNVAENIALGMETPPALRDLATQIRK
VSETYGLPLDPYRTVGDLSAGERQRVEIIRCLLQDPKLLIMDEPTSVLTPQEVEILFQTL
QKLRSEGTSILYISHKLEEIRTLCDHATILRLGKNVGECVPSETSARDMAEMMVGTALQT
PERSGRALGDVALDISGLSVPAPSAFGTALKNVHMTVRKGEILGVGGVAGNGQDELLGVL
SGETTTAADAVTLDGAPIGNLGPVARRRLGILAAPEERLGHAAAPDMSLTENAMLTAATR
EGLASRGFLKWGLAQEFAEKVIKSFDVRTPGPENAARSLSGGNLQKFVIGREVLQRPDVL
VVNQPTWGVDAAAAAAIRQSLLDLAAGGTAVICISQDLDELMEIADSFAALNEGRLSAPR
PTAGLSVDEIGLMMGGAHGMEVAHV
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory