Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39 (characterized)
to candidate GFF3089 PGA1_c31400 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase HpcH
Query= SwissProt::O05151 (258 letters) >FitnessBrowser__Phaeo:GFF3089 Length = 256 Score = 259 bits (662), Expect = 4e-74 Identities = 133/251 (52%), Positives = 170/251 (67%), Gaps = 3/251 (1%) Query: 1 MQSPINSFKKALAEGRTQIGFWLALGDAYSAEVCAGAGFDWLLIDGEHAPQDLRSVLAQL 60 M +P N FK+ALA G QIG W++ G+A AEV GFDWL+IDGEHAP D+RS+ QL Sbjct: 1 MPAPKNIFKQALANGDRQIGCWMSFGEAAVAEVMGTCGFDWLVIDGEHAPNDIRSIRDQL 60 Query: 61 QVIGAYRDCHAAVRVPSADTTVIKQYLDLGAQSLLVPMVDTADEAAAVVRACRYPPGGIR 120 + A D H VRVP +T +IKQ LD GAQ++LVP+V+ AD+A +VRAC+YPP G R Sbjct: 61 MALAA-SDSHPVVRVPVGETWIIKQVLDAGAQTVLVPIVEDADQARELVRACQYPPHGTR 119 Query: 121 GVGG--ARASRWGRYPRYLHEADEQVCVVVQAETALALSNLEAIAEVDGIDGVFIGTADL 178 GVG ARA+ +G Y+ AD+Q+C+++Q E + NL I V G+DG+FIG ADL Sbjct: 120 GVGATAARATLFGTASDYIQTADQQICLLLQVENRKGIENLNEILAVPGVDGIFIGPADL 179 Query: 179 AASLGFPGNPAHPEVQDAILDALQRVRAAGKAPGVLTPVEDLAQKYLAHGAVFVAVGIDT 238 + +GF GN AHPEV+ I DAL R++AAGKAPG+L + Q Y GA F+AVGID Sbjct: 180 STDMGFEGNSAHPEVRAVIADALARIKAAGKAPGILGTSPEATQAYFDMGAQFLAVGIDV 239 Query: 239 HLLAKQTSALA 249 LLAK ALA Sbjct: 240 MLLAKSARALA 250 Lambda K H 0.320 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 256 Length adjustment: 24 Effective length of query: 234 Effective length of database: 232 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory