Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2; 3-carboxymuconate lactonizing enzyme; CMLE (uncharacterized)
to candidate GFF445 PGA1_c04560 putative fumarate lyase
Query= curated2:Q9I6Q8 (459 letters) >FitnessBrowser__Phaeo:GFF445 Length = 449 Score = 249 bits (637), Expect = 1e-70 Identities = 165/440 (37%), Positives = 233/440 (52%), Gaps = 15/440 (3%) Query: 7 NQLFDAYFMAAPMRAVFSDRGRLQGMLDFEAALARAEARTGVVPATAVAPIEAACRAELY 66 +QL+ + F A + +FSD ++ ML E ALA+A+ + G++P + A I A Sbjct: 8 SQLYASLFSAGDVSRLFSDSAEIRAMLLVEGALAKAQGKLGLIPEDSAAAIGRAVMEVAL 67 Query: 67 DPLALAEAVATAGNSAIPLVKALGRQVAAGDAEAERYVHLGATSQDAMDSGLVLQLRRAL 126 DP AL +A G LV AL ++ A E +YVH GATSQD MDS L+L+LR+AL Sbjct: 68 DPGALTQAAGQNGVPVPGLVSALRDEMNA--PEHAQYVHWGATSQDIMDSALMLRLRQAL 125 Query: 127 ALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATPVTLGMKLAGLLGALTRHRQRLRE 186 A +E DL L L+D A+ HA+ P+A RT+ Q ATP + G +A L + L Sbjct: 126 AAVETDLLILLTQLSDMADTHANLPMAARTYGQLATPTSFGAVVAAWGQPLAALLEELPT 185 Query: 187 LRPRLLVLQFGGASGTLAALGEQALPVAAALAEELGLALPEQPWHTQRDRLVEFASVLGL 246 LR L++ GA+GT +ALG +A + A LA L L P + WHT R ++ A L Sbjct: 186 LRQTCLLVSLSGAAGTSSALGPKASELRAELAAGLSLVDPHRSWHTDRSPVLRIADWLTR 245 Query: 247 VAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSSTMPHKRNPVSSAVLIAAATRAPGLV 306 SL K G D L Q+ E+ G SSTMP K+NPV+++ LIA A++A + Sbjct: 246 ACTSLSKLGTDCLALRQSGIDEL---TTITAGASSTMPQKQNPVAASALIALASQATAQL 302 Query: 307 STLFAAMPQEHERSLGLWHAEWETLPELCCLVAGALQQAIGLLEGLEVDAQRMRRNLGLT 366 S L A +H+R W EW +LP++ A A + A+ + +GL DA++M RNL Sbjct: 303 SALHHAAAHQHQRDGASWFGEWLSLPQIVFCAASAARTAVSMTKGLAPDAKQMLRNLHAA 362 Query: 367 HGLVLAEAVSIALARRIGREAAHHLVEQCCRRAVEQRRELRAVLGEEARVSAELSGDELD 426 +G + AEA+S ALA ++ R A V+ C +A +Q L+ V A L ELD Sbjct: 363 NGTIYAEALSFALAEQMRRGEAQAAVKDLCVKAAQQGVPLQEV--------AALQFPELD 414 Query: 427 R--LLDPAHYLGQARAWVER 444 L D LG A +R Sbjct: 415 HATLFDATRQLGSATYEAQR 434 Lambda K H 0.320 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 449 Length adjustment: 33 Effective length of query: 426 Effective length of database: 416 Effective search space: 177216 Effective search space used: 177216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory