Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate GFF3168 PGA1_c32190 2-oxo-hepta-3-ene-1,7-dioic acid hydratase HpcG
Query= metacyc::MONOMER-15110 (260 letters) >FitnessBrowser__Phaeo:GFF3168 Length = 266 Score = 164 bits (414), Expect = 2e-45 Identities = 92/250 (36%), Positives = 143/250 (57%), Gaps = 7/250 (2%) Query: 13 LVDAEVEKKEVLKLTNEHPDLTVEDGYAIQEQLVQMKLEQGYRIVGPKMGLTSQAKMKQM 72 L+ AE +++ L+ HP++ ++D YAIQ + Q KL+QG R++G K+GLTS+A + Sbjct: 13 LLHAEKIGRQIGLLSLRHPEMGMDDAYAIQTAIHQAKLDQGRRVIGWKIGLTSKAMQYAL 72 Query: 73 NVNEPIYGYIFDYMV-VNGQELSMSELIHPKVEAEIAFILGKDIEGPGITGAQVLAATEY 131 N++ P G +FD M+ +G + I P+VEAEIAF++ I G G+T VL AT+Y Sbjct: 73 NIDIPDSGILFDDMLFADGGRVPKGHFIQPRVEAEIAFVMKTAIGGSGVTRTDVLTATDY 132 Query: 132 VVPALEIIDSRYQNFQFTLP------DVIADNASSSRVFLGSTIKRPDNMELDLLGVTLS 185 V PALE++D+R + D I+DNA+++ + LGS D +L +G S Sbjct: 133 VAPALELLDTRIERQDHATGQSRNVFDTISDNAANAGIVLGSQRHAVDAFDLRWVGAITS 192 Query: 186 INGQIKDLGAGAAVVGHPANSVAMLANMLARKGLKLKAGQIILSGGITGAVMLNVGDSVT 245 NG++++ G GA V+ P SV LA +A+ G +++ GQIILSG V G + Sbjct: 193 RNGEVEETGLGAGVLNDPVESVVWLARRMAQYGQRIEPGQIILSGSFIRPVECPSGTDIA 252 Query: 246 GKFDGLGTID 255 F G ++ Sbjct: 253 ADFGPFGAVE 262 Lambda K H 0.317 0.137 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 266 Length adjustment: 25 Effective length of query: 235 Effective length of database: 241 Effective search space: 56635 Effective search space used: 56635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory